BYKdb

Annotate results for A0A0F9I1G8

A0A0F9I1G8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F9I1G8
DOMAINtad32/220EEVHLRDYLEVIARRKWLIFGFLALVFISTLIFTLTATKIYKANAVIEANRDAPRVTKFE
EVTAALASAREFYQAQVSMLKSTTLIQRVIDKMNLGEHPVLSLAKDGKEKKSARASIKEF
VRSLIPQKKEETAKRPVIPKETLKQQGLIGFVNGNLTPILQRNSNLISISFTSPDRHLSQ
DVVNTLIEE
DOMAINcd557/749TSTAPEEGKTTLAANLAFAFAGSEEKVLLMDADLRKPHLHKIFTQWSDGTRPGLSSYLAG
VIDKNLIQKTDIDNLWFVPSGPIPPNPVELLASNRFTELMAVCNQKFDRIILDAPPHHGF
ADILVLSRQVGGVVLVSSIGETTRDALRHFKKGILNVQGTILGCIINKVNLTKRYGYRAY
YKYYQAYNYDYGE
SITEWalker A564/566GKT
SITEWalker A'584/591LLMDADLR
SITEWalker B666/672IILDAPP
SITEY Cluster731/747YGYRAYYKYYQAYNYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLPIAPAPVRRDNEEMLPSTEFRQAAPDWEGEEVHLRDYLEVIARRKWLIFGFLALVFISTLIFTLTATKIYKANAVIEA
                               EEVHLRDYLEVIARRKWLIFGFLALVFISTLIFTLTATKIYKANAVIEA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NRDAPRVTKFEEVTAALASAREFYQAQVSMLKSTTLIQRVIDKMNLGEHPVLSLAKDGKEKKSARASIKEFVRSLIPQKK
NRDAPRVTKFEEVTAALASAREFYQAQVSMLKSTTLIQRVIDKMNLGEHPVLSLAKDGKEKKSARASIKEFVRSLIPQKK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EETAKRPVIPKETLKQQGLIGFVNGNLTPILQRNSNLISISFTSPDRHLSQDVVNTLIEEFVRWKMDQKLEASQLAREFL
EETAKRPVIPKETLKQQGLIGFVNGNLTPILQRNSNLISISFTSPDRHLSQDVVNTLIEE                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TKQIYQSKINLEKVEEELNRFARMSGIVSLDTKLNSVYSQLGELNTALARAEAEMIGKRAIYNQAIKDGPASLPRVLSNL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIANLKADYARLVSQYQDLTTTFLDDYPEVKNLKSRMLSIGERIHIEEKKIFKAIENEYQTALKKRTALQERVSLQKTLA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDLNERATQYKIIAREVETNKGIYQSLLERAKEIESMVGVSSSNIHIVDRALLPIFPFKPNVRLNLLLAIVVGLMGGIGL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFLLEYFADTITNPDQISERFQIPILGVVPLAKSGDYVLDKAFVSEPRAPISEAIRTTKVSLQLSGADALSKCFMITSTA
                                                                            TSTA

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PEEGKTTLAANLAFAFAGSEEKVLLMDADLRKPHLHKIFTQWSDGTRPGLSSYLAGVIDKNLIQKTDIDNLWFVPSGPIP
PEEGKTTLAANLAFAFAGSEEKVLLMDADLRKPHLHKIFTQWSDGTRPGLSSYLAGVIDKNLIQKTDIDNLWFVPSGPIP
   GKT                 LLMDADLR                                                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNPVELLASNRFTELMAVCNQKFDRIILDAPPHHGFADILVLSRQVGGVVLVSSIGETTRDALRHFKKGILNVQGTILGC
PNPVELLASNRFTELMAVCNQKFDRIILDAPPHHGFADILVLSRQVGGVVLVSSIGETTRDALRHFKKGILNVQGTILGC
                         IILDAPP                                                
       730       740       750       760     
....:....|....:....|....:....|....:....|....:
IINKVNLTKRYGYRAYYKYYQAYNYDYGEDNKRKRVKKLKSDREK
IINKVNLTKRYGYRAYYKYYQAYNYDYGE                
          YGYRAYYKYYQAYNYDY                  

© 1998-2019