BYKdb

Annotate results for A0A0F9JKD8

A0A0F9JKD8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F9JKD8
DOMAINtad4/181QEIHLRDYFRILRKRRHVVLTFFFITLALVILFTFTASPLYKADTRLLIEKSEQYTITEY
GFTVYDPEFYSTQYKIIKSRPVARKVYDSLKDNELFIKHFEESPGEGGLAAMIKGLLPGG
GPEDEGADPEAAKRKLIVETILENISVNPEVDTRLVTVSYLSGNPDLARLVVNTLANA
DOMAINcd527/714TSMGPAEGKTATAVNLALVVAQSVGKVLLVDTDLRKPRIHNIFGFSNKSGLSTYLVGSNA
KIIKEGPSPNINIVTSGPLPPNPSELLGSEKFARFLSSMQERYDVLIFDSPPVLTVTDSL
VLSKYVDGTIVVARAAKTSYEAVRKGLRQLNDVGSNVLGLLINAIDARKGGYYYNYYYYH
DYNYYYSA
SITEWalker A534/536GKT
SITEWalker A'554/561LLVDTDLR
SITEWalker B632/638LIFDSPP
SITEY Cluster698/712YYYNYYYYHDYNYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQQQEIHLRDYFRILRKRRHVVLTFFFITLALVILFTFTASPLYKADTRLLIEKSEQYTITEYGFTVYDPEFYSTQYKII
   QEIHLRDYFRILRKRRHVVLTFFFITLALVILFTFTASPLYKADTRLLIEKSEQYTITEYGFTVYDPEFYSTQYKII

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSRPVARKVYDSLKDNELFIKHFEESPGEGGLAAMIKGLLPGGGPEDEGADPEAAKRKLIVETILENISVNPEVDTRLVT
KSRPVARKVYDSLKDNELFIKHFEESPGEGGLAAMIKGLLPGGGPEDEGADPEAAKRKLIVETILENISVNPEVDTRLVT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSYLSGNPDLARLVVNTLANAYIEALFELRMDSSQRALQWMSRKVEEERNKLDDSESGLQAYMKANDIVTLEDRIAIVPQ
VSYLSGNPDLARLVVNTLANA                                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLLELSTQLTRSETRRKELETLRNKIRSLKAAGKDLDSLPAIASDKTVASLRGQVLKGEQRITEFSKKYGQKHPLMIESV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDLRVLREKKEQEIGRVVKSVENEYDLALSNEHNIRRLLSETKLEAHGINEKFVKYNSLKREVDTNRKLFESLLQKMHKE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RIEEEGQTVNVMLVETAETPSYPESPKKALNLIIGFMIGILGGAMLAFFFEYFDNTVKAAEDAEEKLGIPVLGMVSHLRR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKKGKERHIERIVIEEPKSSFAENYKALRTAIMLSSAESTPKTLLITSMGPAEGKTATAVNLALVVAQSVGKVLLVDTDL
                                              TSMGPAEGKTATAVNLALVVAQSVGKVLLVDTDL
                                                     GKT                 LLVDTDL
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPRIHNIFGFSNKSGLSTYLVGSNAKIIKEGPSPNINIVTSGPLPPNPSELLGSEKFARFLSSMQERYDVLIFDSPPVL
RKPRIHNIFGFSNKSGLSTYLVGSNAKIIKEGPSPNINIVTSGPLPPNPSELLGSEKFARFLSSMQERYDVLIFDSPPVL
R                                                                      LIFDSPP  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVTDSLVLSKYVDGTIVVARAAKTSYEAVRKGLRQLNDVGSNVLGLLINAIDARKGGYYYNYYYYHDYNYYYSAKDEEGE
TVTDSLVLSKYVDGTIVVARAAKTSYEAVRKGLRQLNDVGSNVLGLLINAIDARKGGYYYNYYYYHDYNYYYSA      
                                                         YYYNYYYYHDYNYYY        
 
.
E


© 1998-2019