BYKdb

Annotate results for A0A0F9U8M8

A0A0F9U8M8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F9U8M8
DOMAINtad13/190NTLDLKRYLHACMEYKWRLIFISSLISVIAAFVVMQIKPTYESTATLLIEPEQKNVVSID
EMYGFNTAKREFYSTQFEILQSKYIAEAVIEKLNLIKHPEFNDEENNLFGLKALFSSFFG
EGGTDDELDLEYKMAHLINDFRQRLSVKPIQGTQLVHITYQASDRKLAAKIANAIGEV
DOMAINcd533/724TSSIPGEGKTTTSINLAFSLGQIEKVLLIDADMRKPSICKRFDMPTYHPGLSNFIAGTDT
LENCLYQDEQSGITVMPCGQLPPNPLELLSSNKFSKVIEQLKEKFDRIIIDTAPIQAVSD
SLMISKSVDSVIYVVKSDDTHLSIIKNGIGRLLQDKAKLAGVVLNHVDTDKVAKTQGYNG
YYDYYSYGKKNT
SITEWalker A540/542GKT
SITEWalker A'559/566LLIDADMR
SITEWalker B640/646IIIDTAP
SITEY Cluster710/719YNGYYDYYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNTSSNTFLETNNTLDLKRYLHACMEYKWRLIFISSLISVIAAFVVMQIKPTYESTATLLIEPEQKNVVSIDEMYGFNTA
            NTLDLKRYLHACMEYKWRLIFISSLISVIAAFVVMQIKPTYESTATLLIEPEQKNVVSIDEMYGFNTA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KREFYSTQFEILQSKYIAEAVIEKLNLIKHPEFNDEENNLFGLKALFSSFFGEGGTDDELDLEYKMAHLINDFRQRLSVK
KREFYSTQFEILQSKYIAEAVIEKLNLIKHPEFNDEENNLFGLKALFSSFFGEGGTDDELDLEYKMAHLINDFRQRLSVK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PIQGTQLVHITYQASDRKLAAKIANAIGEVYIETHLEAKLGVTRRASAWMSEKMAGLTKQLERSETAFESFRQKNNIVDI
PIQGTQLVHITYQASDRKLAAKIANAIGEV                                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSAVLRIDSELEKTQATLAIAESDKSKVDSILELINRFGKSDFENLKSLPEIISHSSISEGRVLLETAELKFAELSKIYG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PKHPKLIAASEELDMRVEQVNAQIQSLISGIEKESYTAAQRVKRYRKELSDIRSKYSDITGLDTKYTALKIELDTNRNLY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTFLERSRETEATSDYKASPAHFTGVAAASLYPVKPNKKMIVAGAFFLSLMFFVGLVILFEMLDDTIKSPSDIESKLSMR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLGMIPLSKNTALDIRTFFDKEQQQFSEAVRTLRTGVVLSQMDAENNKVIEVTSSIPGEGKTTTSINLAFSLGQIEKVLL
                                                    TSSIPGEGKTTTSINLAFSLGQIEKVLL
                                                           GKT                LL
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADMRKPSICKRFDMPTYHPGLSNFIAGTDTLENCLYQDEQSGITVMPCGQLPPNPLELLSSNKFSKVIEQLKEKFDRI
IDADMRKPSICKRFDMPTYHPGLSNFIAGTDTLENCLYQDEQSGITVMPCGQLPPNPLELLSSNKFSKVIEQLKEKFDRI
IDADMR                                                                         I
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIDTAPIQAVSDSLMISKSVDSVIYVVKSDDTHLSIIKNGIGRLLQDKAKLAGVVLNHVDTDKVAKTQGYNGYYDYYSYG
IIDTAPIQAVSDSLMISKSVDSVIYVVKSDDTHLSIIKNGIGRLLQDKAKLAGVVLNHVDTDKVAKTQGYNGYYDYYSYG
IIDTAP                                                               YNGYYDYYSY 
    
....
KKNT
KKNT

© 1998-2019