BYKdb

Annotate results for A0A0F9UWR4

A0A0F9UWR4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F9UWR4
DOMAINtad21/206DYIDLKKIWYAIWSRKWSIISLVVVVSMLATLAVMQMTPVYRASTTMMIEGKGNQLVAFQ
QVYDNTGQLNEYLQTQIGLISSRGVAERVVRELNLVEHPEFDPRQQDQPLIDIRGIIKSL
QGMVLGEDPSDGAEPMTEAQIMDNVTQQFMQRVSVSVEGKSQLVRISVEMADRLTAAQAA
NSVANS
DOMAINcd550/739TSSVPGEGKSSVAANMAFALGQLQRVLLIDADLRRPTLARNFDFPVGTPGLANLIAGTAK
VEDCIQTVDAQLDMLTAGAVPPNPLELLASPRFAKFLERVKDRYDHILIDSPPTQAVSDS
VLMSTYADSVIYVIKSESTSISMAQKGVGQLLQSGASIVGVVLNQVDVKKAAKKGEYSGY
YDHYGYSEQN
SITEWalker A557/559GKS
SITEWalker A'576/583LLIDADLR
SITEWalker B656/662ILIDSPP
SITE-675/-681YADSVIY
SITEY Cluster726/735YSGYYDHYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNSSIRPDRQWQPMPSDDDTDYIDLKKIWYAIWSRKWSIISLVVVVSMLATLAVMQMTPVYRASTTMMIEGKGNQLVAFQ
                    DYIDLKKIWYAIWSRKWSIISLVVVVSMLATLAVMQMTPVYRASTTMMIEGKGNQLVAFQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVYDNTGQLNEYLQTQIGLISSRGVAERVVRELNLVEHPEFDPRQQDQPLIDIRGIIKSLQGMVLGEDPSDGAEPMTEAQ
QVYDNTGQLNEYLQTQIGLISSRGVAERVVRELNLVEHPEFDPRQQDQPLIDIRGIIKSLQGMVLGEDPSDGAEPMTEAQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IMDNVTQQFMQRVSVSVEGKSQLVRISVEMADRLTAAQAANSVANSYIEGQLEAQMEMSMAATTWMNSRLSELRTSLKEA
IMDNVTQQFMQRVSVSVEGKSQLVRISVEMADRLTAAQAANSVANS                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENRLQAYREQEGLVDVDGVGTVSANELALTGDRMVDARSQRAEAESQYRQVQAMSEQGWERMASVPAVLGHPLIQQFKSE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QARARARVEELSRRYGERYPAMQAAQSDLNAATASLRAQVEQVVAGIERNYQLAVANEQSVRASFDANKEQIQDISRKEF


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVRELTREVESNRELYETFMTRLRETTSTQDLSTTNARIVDQAIPPSRPSAPNTKLLIIIATMLALIVGVAIALIADFLN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTFKSAEDVENNLNLPVLGIVPLVAKKQQKKVSHLFEKGDDMRFCEAVRTIRTSVMLADMSRPQKVIVITSSVPGEGKSS
                                                                     TSSVPGEGKSS
                                                                            GKS 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAANMAFALGQLQRVLLIDADLRRPTLARNFDFPVGTPGLANLIAGTAKVEDCIQTVDAQLDMLTAGAVPPNPLELLASP
VAANMAFALGQLQRVLLIDADLRRPTLARNFDFPVGTPGLANLIAGTAKVEDCIQTVDAQLDMLTAGAVPPNPLELLASP
               LLIDADLR                                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFAKFLERVKDRYDHILIDSPPTQAVSDSVLMSTYADSVIYVIKSESTSISMAQKGVGQLLQSGASIVGVVLNQVDVKKA
RFAKFLERVKDRYDHILIDSPPTQAVSDSVLMSTYADSVIYVIKSESTSISMAQKGVGQLLQSGASIVGVVLNQVDVKKA
               ILIDSPP                                                          
       730       740
....:....|....:....|
AKKGEYSGYYDHYGYSEQNA
AKKGEYSGYYDHYGYSEQN 
     YSGYYDHYGY     

© 1998-2019