BYKdb

Annotate results for A0A0F9XPI6

A0A0F9XPI6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F9XPI6
DOMAINtad15/251DRFDLGEILKKYIKYWPWFAASFLLTLAFAVFYLLSTAKIYESVAKIKIVDNSTDIGLQS
NAMSLFTNGSTINLDNQIEILTSYRILSEVVKELQLDVTYYLKGKLKDKQVWDAPFIVVK
ETSEELKKAQSLSVNFMANDIEVTDSNGNNFTLFYKQSENALKTSPFRILMIDTLQNLNL
IGQEYEVVISPIKNTVLGLINKMEIQTTTKDSDVLAISLSGNYPTKSELILNTLIKK
DOMAINcd584/769TSGYMGEGKSLLAYNLSVAYASINKKVLLIDADLRSPEQHKYFKMDRNTKGLTDYLKEEE
INWKSFIFSGLEKSKNHHVCLSGAIPPNAPQLLSNGAFEKFITNAKEYYDLIVVDTAPAV
PVTDTLLIADYADVTLFVIRAGVTDKAILHGASEDSHRDKLKNMAYVLNDVHARNIKSYN
YGYGEV
SITEWalker A591/593GKS
SITEWalker A'611/618LLIDADLR
SITEWalker B695/701IVVDTAP
SITE-597/-603YNLSVAY
SITE-691/-692YY
SITEY Cluster762/766YNYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTETPFNLDYDQKQDRFDLGEILKKYIKYWPWFAASFLLTLAFAVFYLLSTAKIYESVAKIKIVDNSTDIGLQSNAMSLF
              DRFDLGEILKKYIKYWPWFAASFLLTLAFAVFYLLSTAKIYESVAKIKIVDNSTDIGLQSNAMSLF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TNGSTINLDNQIEILTSYRILSEVVKELQLDVTYYLKGKLKDKQVWDAPFIVVKETSEELKKAQSLSVNFMANDIEVTDS
TNGSTINLDNQIEILTSYRILSEVVKELQLDVTYYLKGKLKDKQVWDAPFIVVKETSEELKKAQSLSVNFMANDIEVTDS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NGNNFTLFYKQSENALKTSPFRILMIDTLQNLNLIGQEYEVVISPIKNTVLGLINKMEIQTTTKDSDVLAISLSGNYPTK
NGNNFTLFYKQSENALKTSPFRILMIDTLQNLNLIGQEYEVVISPIKNTVLGLINKMEIQTTTKDSDVLAISLSGNYPTK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SELILNTLIKKFNQDGINDRQQVSKRTLDFIDERFVYLSTELDSIEGGKQAFKTRNNLSYIEADAGVSLERKSETENDVI
SELILNTLIKK                                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLETQISLSALLKNSVVGQAAFELLPVDVGLENSGLNSMVDRYNDQVLQRNKLLQTVGIQHPSLIAISTQLEVAKVNIIK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TINIYQTQLRTSLIQSNQAQNKVNSVFSGLPEKEKMLRSIERQQSIKENLFLLLLQKREEAGISLAVTTPLVKIVDYALT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STTPIAPKKTIILGVSGILGLLIPFVFFYIKFSLNDKIGSKSDVLAIESSIPFLGEIPHFKTEKKFIDFNDHSVLAESFR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILATNINYMLPKRKDGSGNVIFVTSGYMGEGKSLLAYNLSVAYASINKKVLLIDADLRSPEQHKYFKMDRNTKGLTDYLK
                       TSGYMGEGKSLLAYNLSVAYASINKKVLLIDADLRSPEQHKYFKMDRNTKGLTDYLK
                              GKS                 LLIDADLR                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEEINWKSFIFSGLEKSKNHHVCLSGAIPPNAPQLLSNGAFEKFITNAKEYYDLIVVDTAPAVPVTDTLLIADYADVTLF
EEEINWKSFIFSGLEKSKNHHVCLSGAIPPNAPQLLSNGAFEKFITNAKEYYDLIVVDTAPAVPVTDTLLIADYADVTLF
                                                      IVVDTAP                   
       730       740       750       760         
....:....|....:....|....:....|....:....|....:....
VIRAGVTDKAILHGASEDSHRDKLKNMAYVLNDVHARNIKSYNYGYGEV
VIRAGVTDKAILHGASEDSHRDKLKNMAYVLNDVHARNIKSYNYGYGEV
                                         YNYGY   

© 1998-2019