BYKdb

Annotate results for A0A0G3EFP6

A0A0G3EFP6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0G3EFP6
DOMAINtad15/166GGLHFLDYWRVIRARKEIILAVALLVVLVGTAYTFTLPRIYRSTATIKVNNEGTDVDVFR
NEGGRSLYNPYFLRTQQRIISSRPVLYEVIERLNLRKVWGNEDRKIPEDVALNILRRSIN
LSAAPDTSLISIIAEREKPEEAARIANQVAEV
DOMAINcd505/695TSGGAGEGKSTTIFNLAYICAQRGEKVLLIDSDLRRPVQHRILDTDNRFGLTNVLLRDVP
VEETIKPTSVPNLHFLPSGRLPRTSLGLLESQRMKELIHNLRSKFDVIFLDSPPVIGISD
ASILASAVDRVIMVCQYRKYPRDMAMRAKQLLESSNARVSGVVLNNINVMRDDYYYYYHS
YYYNYYYYRSG
SITEWalker A512/514GKS
SITEWalker A'532/539LLIDSDLR
SITEWalker B612/618IFLDSPP
SITE-641/-644YRKY
SITEY Cluster678/692YYYYYHSYYYNYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDQPNPNQQQKDSDGGLHFLDYWRVIRARKEIILAVALLVVLVGTAYTFTLPRIYRSTATIKVNNEGTDVDVFRNEGGRS
              GGLHFLDYWRVIRARKEIILAVALLVVLVGTAYTFTLPRIYRSTATIKVNNEGTDVDVFRNEGGRS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LYNPYFLRTQQRIISSRPVLYEVIERLNLRKVWGNEDRKIPEDVALNILRRSINLSAAPDTSLISIIAEREKPEEAARIA
LYNPYFLRTQQRIISSRPVLYEVIERLNLRKVWGNEDRKIPEDVALNILRRSINLSAAPDTSLISIIAEREKPEEAARIA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQVAEVYRDMRRDVKRKEMRNAIEELRTQLQKQQTKVDEAEQEMERIRQELDVTFVGNEQSGVSVDKMRLQQLEGDRIQA
NQVAEV                                                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVEMLVRKARFEQMQALEGPELLNASEYVVKDPNLSDLRKQILDTDVSLSLMSENYGQNHPEVKRLRAAREELMGKLEEA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDGLIKGLKADYEVARANYEALEKELAGIREEERQTQRESLLPFNKARRNLEIQRSILDALKARVTQEGITLEIPRTAVE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIEPAEPGSSPVSPNLFLNVLMSVFLGLGAGVGLAYFIEYLDTSIKTADDVERYLSLPVLGLVPQKVRPMIEEGPDSEHA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAYRVLRTNLTFTNEGQTKGTFLCTSGGAGEGKSTTIFNLAYICAQRGEKVLLIDSDLRRPVQHRILDTDNRFGLTNVLL
                        TSGGAGEGKSTTIFNLAYICAQRGEKVLLIDSDLRRPVQHRILDTDNRFGLTNVLL
                               GKS                 LLIDSDLR                     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDVPVEETIKPTSVPNLHFLPSGRLPRTSLGLLESQRMKELIHNLRSKFDVIFLDSPPVIGISDASILASAVDRVIMVCQ
RDVPVEETIKPTSVPNLHFLPSGRLPRTSLGLLESQRMKELIHNLRSKFDVIFLDSPPVIGISDASILASAVDRVIMVCQ
                                                   IFLDSPP                      
       650       660       670       680       690       700       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
YRKYPRDMAMRAKQLLESSNARVSGVVLNNINVMRDDYYYYYHSYYYNYYYYRSGESAPQETETAEG
YRKYPRDMAMRAKQLLESSNARVSGVVLNNINVMRDDYYYYYHSYYYNYYYYRSG            
                                     YYYYYHSYYYNYYYY               

© 1998-2019