BYKdb

Annotate results for A0A0G3EPM4

A0A0G3EPM4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0G3EPM4
DOMAINtad18/272GAVTPREALRLVADKARVVLLITAILVAFSALYAFLAQPIYSANALLRVSPPNANELGIG
NRQKQMTLPENPDTATEIQLVKSREILLPAIKRFHLDIHVAAQRLPLIGSIAEKFAKDGH
PAAPWFGLENYAWGGEAVSIGQLHVPPELQNKPLELRVLPGRRFGLYDPAGTLLVTGEVG
VPAQGAGVTVLVNRLSARAHTRFTVTRYDDITAVNLMLRHLQVVEEGKNTGVVKVSYENS
NPVLAMQVTNAVVQG
DOMAINcd595/781SAPTPETGKSFVAANLAVLEAETGKRVLLIDGDMRRGRLATHFGHPDAPGLSELLMGRAE
IAQVIQSAGVGGMSFLAAGRTPGHPAELLSTRHMEGLLKMFSERFDLVVIDTPPVLAVAD
APILARHAGTTVLVLRPNAQTEREIEDSVIWLGRAGARVAGTIFNAMPPRRGEKRSYVYA
YASAPDS
SITEWalker A602/604GKS
SITEWalker A'622/629LLIDGDMR
SITEWalker B702/708VVIDTPP
SITEY Cluster771/775YVYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSVRNIEWGAVPLRRGSGAVTPREALRLVADKARVVLLITAILVAFSALYAFLAQPIYSANALLRVSPPNANELGIGNRQ
                 GAVTPREALRLVADKARVVLLITAILVAFSALYAFLAQPIYSANALLRVSPPNANELGIGNRQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQMTLPENPDTATEIQLVKSREILLPAIKRFHLDIHVAAQRLPLIGSIAEKFAKDGHPAAPWFGLENYAWGGEAVSIGQL
KQMTLPENPDTATEIQLVKSREILLPAIKRFHLDIHVAAQRLPLIGSIAEKFAKDGHPAAPWFGLENYAWGGEAVSIGQL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HVPPELQNKPLELRVLPGRRFGLYDPAGTLLVTGEVGVPAQGAGVTVLVNRLSARAHTRFTVTRYDDITAVNLMLRHLQV
HVPPELQNKPLELRVLPGRRFGLYDPAGTLLVTGEVGVPAQGAGVTVLVNRLSARAHTRFTVTRYDDITAVNLMLRHLQV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEEGKNTGVVKVSYENSNPVLAMQVTNAVVQGYLAANAASHQEEANKMLTFVQGELPRLRAELDDAERKLSQYRTHAGTM
VEEGKNTGVVKVSYENSNPVLAMQVTNAVVQG                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPDRESQSYLRGGIDFDRQIAALKLQRTQLLSRFTANSPEVRNIDQQLAELEGYKHSFTARFDNLPASQRRLAELTRNEK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VASEIYVAMVNRAQELSVTRASNFGNVRIVDTALVPQKPIRPRRALIVAVATLLGLLLGALYVLLRRQLSSRIDDPLLVE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRLRLPVFGTIAFSNQQSRLAGAAQGQLLAAHDERPGDLEPRLRPALAIPPPAQASARSRALEPAEPGSGEEIRAPRGVM


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVNRPHDVTVEALRSVRTALQSGAASATNNILVVSAPTPETGKSFVAANLAVLEAETGKRVLLIDGDMRRGRLATHFGHP
                                  SAPTPETGKSFVAANLAVLEAETGKRVLLIDGDMRRGRLATHFGHP
                                         GKS                 LLIDGDMR           
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAPGLSELLMGRAEIAQVIQSAGVGGMSFLAAGRTPGHPAELLSTRHMEGLLKMFSERFDLVVIDTPPVLAVADAPILAR
DAPGLSELLMGRAEIAQVIQSAGVGGMSFLAAGRTPGHPAELLSTRHMEGLLKMFSERFDLVVIDTPPVLAVADAPILAR
                                                             VVIDTPP            
       730       740       750       760       770       780    
....:....|....:....|....:....|....:....|....:....|....:....|....
HAGTTVLVLRPNAQTEREIEDSVIWLGRAGARVAGTIFNAMPPRRGEKRSYVYAYASAPDSAGY
HAGTTVLVLRPNAQTEREIEDSVIWLGRAGARVAGTIFNAMPPRRGEKRSYVYAYASAPDS   
                                                  YVYAY         

© 1998-2019