BYKdb

Annotate results for A0A0G3QAX2

A0A0G3QAX2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0G3QAX2
DOMAINtad16/252DEIDVGRLIGTVVEARWWVLGITGLFAVAAIVYCLFATPIYSADALVQIEQNTGNSLVQD
IGSALANKPPASEAEIQLIQSRLVLGKTVNDLNLDIAVTKNTFPVFGAGWDRLMGRQDDT
VKVTTFTLPKEMKDQVFTLKVLGPKQYSLTSDGGFSAHGEVGQPLSKDGVTMVVSAIQAA
NDSEFTVTKFSTLGMINNLQNNLSVTENGKDTGVLSLTYTGEDRDQIRDILNSITRN
DOMAINcd532/719TGVSPSIGKTFVCANLAAVISQTNKRVLMIDCDMRKGYTHELLGTDNVNGLSDILVGKGS
IENCAKKTSIANFDLVPRGQIPPNPSELLMSERFTQLLDWASKHYDLVLIDTPPILAVTD
AAIVGRHAGTTLMVARYAVNTVKEVQTSLSRFEQNGIQVKGVILNSIFRRATGYQDYGYY
EYEYKSDS
SITEWalker A539/541GKT
SITEWalker A'559/566LMIDCDMR
SITEWalker B639/645VLIDTPP
SITEY Cluster705/715YQDYGYYEYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTEKTHHSAASTVGNDEIDVGRLIGTVVEARWWVLGITGLFAVAAIVYCLFATPIYSADALVQIEQNTGNSLVQDIGSAL
               DEIDVGRLIGTVVEARWWVLGITGLFAVAAIVYCLFATPIYSADALVQIEQNTGNSLVQDIGSAL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANKPPASEAEIQLIQSRLVLGKTVNDLNLDIAVTKNTFPVFGAGWDRLMGRQDDTVKVTTFTLPKEMKDQVFTLKVLGPK
ANKPPASEAEIQLIQSRLVLGKTVNDLNLDIAVTKNTFPVFGAGWDRLMGRQDDTVKVTTFTLPKEMKDQVFTLKVLGPK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYSLTSDGGFSAHGEVGQPLSKDGVTMVVSAIQAANDSEFTVTKFSTLGMINNLQNNLSVTENGKDTGVLSLTYTGEDRD
QYSLTSDGGFSAHGEVGQPLSKDGVTMVVSAIQAANDSEFTVTKFSTLGMINNLQNNLSVTENGKDTGVLSLTYTGEDRD

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QIRDILNSITRNYLQQNVERKSEEAAKSLEFLNKQLPEVRAKLDVAENKLNTYRQQQDSVDLPLEAKSVLDSMVNIDAQL
QIRDILNSITRN                                                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NELTFKEAEISKLYTKAHPAYRTLLEKRKALEDEKAKLNTRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELRITE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASTVGDVRIVDAAITQPGVLKPKKALIILGSVILGLILSVVVVLLRSLFNRGIESPQSLEEQGISVYASIPLSEWQKARD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVKTVKGSKRYKQRQLLAVGNPADLAIEAVRSLRTSLHFAMMQAPNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLM
                                                   TGVSPSIGKTFVCANLAAVISQTNKRVLM
                                                          GKT                 LM
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDCDMRKGYTHELLGTDNVNGLSDILVGKGSIENCAKKTSIANFDLVPRGQIPPNPSELLMSERFTQLLDWASKHYDLVL
IDCDMRKGYTHELLGTDNVNGLSDILVGKGSIENCAKKTSIANFDLVPRGQIPPNPSELLMSERFTQLLDWASKHYDLVL
IDCDMR                                                                        VL
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDTPPILAVTDAAIVGRHAGTTLMVARYAVNTVKEVQTSLSRFEQNGIQVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
IDTPPILAVTDAAIVGRHAGTTLMVARYAVNTVKEVQTSLSRFEQNGIQVKGVILNSIFRRATGYQDYGYYEYEYKSDS 
IDTPP                                                           YQDYGYYEYEY     

© 1998-2019