BYKdb

Annotate results for A0A0G3V3F3

A0A0G3V3F3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0G3V3F3
DOMAINcd299/475VSNTQDAGKSFISINLAQSASALDDKVVLIDADLRRPTIHEQLSVPRTPGLTSVLLGSDL
SEALRKVAESPFLRVLSSGPPVEDPSAILGARAFRVVLDTLRAVRLVVVDTPPSGLFSDA
LAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTEVVNRSAYYEA
SITEWalker A306/308GKS
SITEWalker A'326/333VLIDADLR
SITEWalker B405/411VVVDTPP
SITEY Cluster472/473YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDLAAHFRIIARAWKQILIAGVLVAVAMFFWSNRAERVYEATALLAVTPSDTGLGINADQATFLAKSYALYAETPRVTAA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAKSSGLDITANDAASLISASAVGDLGFLEVYAKGPSVSEAEQLSSAATVALIDAVRAQQTASLAQDIAPIQAQRVILQK


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLSNLPAFDPQAASIQANIDALNKVEAERRAQPANRVNVAASAHASSTPISPHPTRSAVVAFLLTCILVGELIVASRAIG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRIGRTGDDDADVARITGLPVLGRIPKGEGFETVEAFRVLRTNLMVLEAAGRPRTVAVVSNTQDAGKSFISINLAQSASA
                                                          VSNTQDAGKSFISINLAQSASA
                                                                 GKS            
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDDKVVLIDADLRRPTIHEQLSVPRTPGLTSVLLGSDLSEALRKVAESPFLRVLSSGPPVEDPSAILGARAFRVVLDTLR
LDDKVVLIDADLRRPTIHEQLSVPRTPGLTSVLLGSDLSEALRKVAESPFLRVLSSGPPVEDPSAILGARAFRVVLDTLR
     VLIDADLR                                                                   
       410       420       430       440       450       460       470     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
AVRLVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTEVVNRSAYYEA
AVRLVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTEVVNRSAYYEA
    VVVDTPP                                                            YY  
© 1998-2019