BYKdb

Annotate results for A0A0G3V3M7

A0A0G3V3M7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0G3V3M7
DOMAINcd393/582TSPGPAEGKSISVVNIAAAFAETGISVLLIDGDFRRPQMYKYFSGATTPNLTDIPHQGTA
ADVLAVAQETGIPNIRFIASAPTRTDPGTAIEMVKVAARLGRDIADLVIVDSPPILLAND
AAELSTFCDATVLMVRAGWTRRGGVVAASDLLRRLEATTVGVVLVGAEHGARAGYYGYYG
YYGYGYGYAH
SITEWalker A400/402GKS
SITEWalker A'420/427LLIDGDFR
SITEWalker B500/506VIVDSPP
SITE-432/-434YKY
SITEY Cluster567/580YYGYYGYYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRPADYLRIVRRRWWVLLVTVVIAMTFALLTRPSSAATAKASRPGVSFRATTTLISSGSANTSVNGRDYDRLALLMITGE


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPKRVAEAIDEVRWPQIQNANANKCTETGADATSPDCKKSGRRVSAGSGQVELGTGGFIKASAIPDPATGSLAITAQVGD


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AELAAKVANLFAAKLVGYVDELGQKQYDEQIFGLTISRGNSETLISKIDSQLAAPGLSASEYDSLDIRREAVLRKLANAD


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDLSNLQEIGPQTSGLTTLEAATKGRATIIVSRAQGSTSESQRLLFGAAIGFIVGLGILLLLEILSARIRDVPGTEGAAR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPVIAEIPVMNLDRSLRFQVTTAVDPTSLMAEAYRSFRTSLVAMWQRHPTNNRPVLAGASEPEATPLRVLLVTSPGPAEG
                                                                        TSPGPAEG
                                                                               G
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSISVVNIAAAFAETGISVLLIDGDFRRPQMYKYFSGATTPNLTDIPHQGTAADVLAVAQETGIPNIRFIASAPTRTDPG
KSISVVNIAAAFAETGISVLLIDGDFRRPQMYKYFSGATTPNLTDIPHQGTAADVLAVAQETGIPNIRFIASAPTRTDPG
KS                 LLIDGDFR                                                     
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAIEMVKVAARLGRDIADLVIVDSPPILLANDAAELSTFCDATVLMVRAGWTRRGGVVAASDLLRRLEATTVGVVLVGAE
TAIEMVKVAARLGRDIADLVIVDSPPILLANDAAELSTFCDATVLMVRAGWTRRGGVVAASDLLRRLEATTVGVVLVGAE
                   VIVDSPP                                                      
       570       580       590       600       610       620       630     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
HGARAGYYGYYGYYGYGYGYAHPGEVPKMSRLFPWRKPTNGAGTVRRKPDPEQVGVSASNQGANSSSEAFDDPSF
HGARAGYYGYYGYYGYGYGYAH                                                     
      YYGYYGYYGYGYGY                                                       
© 1998-2019