BYKdb

Annotate results for A0A0G3XAM8

A0A0G3XAM8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0G3XAM8
DOMAINtad22/181GILAMERYWRQAVNSRVWIAAILAAGLVLGLLVTLLSTPLYQSTAVIEISRVSSNVTNID
QTEIEELQADEQYFQTQYELLGSRFLAEAVVDAGNLTASEEFRNAFAGDPDVPLKRNEAV
KILLENVSIQPVRMSNLVNVNFSSPNRALSSDIANLWAEQ
DOMAINcd519/710TSTRPNEGKSLTSVAICRSFAQLGKRTLLIDADLRNTALADFLGKQATADTGLSSLLAGR
GESLSHVIPIEEHGFDLIPSGATPPNPADLLASDALARLIREFEQSYDFILVDGPPVLGL
ADALEISTAVEGAIYVIESNDVKIRAIDNALRRLRSANAKIYGAIVTKLDARNSAYGYGY
GYGYGYGYGDSD
SITEWalker A526/528GKS
SITEWalker A'546/553LLIDADLR
SITEWalker B628/634ILVDGPP
SITEY Cluster694/706YGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MANALPYDTELEPVDEGEEKPGILAMERYWRQAVNSRVWIAAILAAGLVLGLLVTLLSTPLYQSTAVIEISRVSSNVTNI
                     GILAMERYWRQAVNSRVWIAAILAAGLVLGLLVTLLSTPLYQSTAVIEISRVSSNVTNI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DQTEIEELQADEQYFQTQYELLGSRFLAEAVVDAGNLTASEEFRNAFAGDPDVPLKRNEAVKILLENVSIQPVRMSNLVN
DQTEIEELQADEQYFQTQYELLGSRFLAEAVVDAGNLTASEEFRNAFAGDPDVPLKRNEAVKILLENVSIQPVRMSNLVN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNFSSPNRALSSDIANLWAEQFLAANYEKRFGANIDARRYLRDQIAELRERLAQSEKELVDYANANQIVIIDAASSSNDD
VNFSSPNRALSSDIANLWAEQ                                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSSSTARSLIGDSLTTLNAALAQATAKRIAAQSALQARSTSNETRSASSQLQNALAAAEAKLASLQANFGPDYPEVQAAR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEVEAMREAISSSRGRDMSALEAAYRQARGEESALQAQVQQIQDRFLSQQGGGIQYGILKREVDTNRQLYDALLQRSKEL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAAGAGKNNMTLVQPALPAEEPYRPSLILNLALSLLAAGAVAAAFVFLRETMDQTVRDPNDVQRLLGVPTLGLIPRVNEN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DILEELHRRSSELSEAYVAVRSNISFLTPSGAPKSLMLTSTRPNEGKSLTSVAICRSFAQLGKRTLLIDADLRNTALADF
                                      TSTRPNEGKSLTSVAICRSFAQLGKRTLLIDADLRNTALADF
                                             GKS                 LLIDADLR       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGKQATADTGLSSLLAGRGESLSHVIPIEEHGFDLIPSGATPPNPADLLASDALARLIREFEQSYDFILVDGPPVLGLAD
LGKQATADTGLSSLLAGRGESLSHVIPIEEHGFDLIPSGATPPNPADLLASDALARLIREFEQSYDFILVDGPPVLGLAD
                                                                   ILVDGPP      
       650       660       670       680       690       700       710        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
ALEISTAVEGAIYVIESNDVKIRAIDNALRRLRSANAKIYGAIVTKLDARNSAYGYGYGYGYGYGYGDSDRETNAPAS
ALEISTAVEGAIYVIESNDVKIRAIDNALRRLRSANAKIYGAIVTKLDARNSAYGYGYGYGYGYGYGDSD        
                                                     YGYGYGYGYGYGY            

© 1998-2019