BYKdb

Annotate results for A0A0G9MCI5

A0A0G9MCI5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0G9MCI5
DOMAINtad24/163DGITLMDLLKIIRKHLATAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATYNASQNGVDI
NQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNI
AVVDGDPKQAADIANSVAES
DOMAINcd296/485TSAQPSEGKTTMAINTAVALAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMG
PKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVEQALTQYDYVIIDTAPLTVSND
GAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYYY
YYEDGAPRSS
SITEWalker A303/305GKT
SITEWalker A'323/330LLIDADLR
SITEWalker B403/409VIIDTAP
SITE-400/-402YDY
SITEY Cluster473/477YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTSVENANVQQPTAPQGVVEEADDGITLMDLLKIIRKHLATAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATYNASQNG
                       DGITLMDLLKIIRKHLATAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATYNASQNG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDINQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAADIANSV
VDINQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAADIANSV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDVRGIVRA
AES                                                                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIEFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVALAEDGA
                                                       TSAQPSEGKTTMAINTAVALAEDGA
                                                              GKT               
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVEQALTQY
KVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVEQALTQY
  LLIDADLR                                                                      
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYYYYYEDG
DYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYYYYYEDG
  VIIDTAP                                                               YYYYY   
       490    
....:....|....
APRSSHRAKGKKRH
APRSS         

© 1998-2019