BYKdb

Annotate results for A0A0G9MRA3

A0A0G9MRA3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0G9MRA3
DOMAINtad22/181QALDLSRLAARAVQLRYWLAGLFAAAIVIAIIFTTLQTPLFRSTAQIEISRVEISAGDSG
DLAAAGQENRDQQYFNTQYELLRSRAVATRVVDALDLSEDEQFASAYSADPGQISPERAA
SLILGSVEILPIPQSNLVDIAVSSPSADLSARLANAWAEQ
DOMAINcd513/700TSARPGEGKTSSSLALAKSFADMGEKVVLVDFDLRRRGVSRLLGPAASDRGMLGFLKGST
PEPTFHSLTDYGVDFVGTSDIEREPVSLLTRPRIGALMNLLQSRYDRIVIDAPPVLGLAD
SVELAQSVDGVVFVIEANVGSANAVRRALSRLRDANAPLLGSFVTKLDQRNALYGYGGDY
GYGYSYSQ
SITEWalker A520/522GKT
SITEWalker A'540/547VLVDFDLR
SITEWalker B620/626IVIDAPP
SITEY Cluster686/698YGYGGDYGYGYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTDTAVTTAGEGPYYTANTQFQALDLSRLAARAVQLRYWLAGLFAAAIVIAIIFTTLQTPLFRSTAQIEISRVEISAGDS
                     QALDLSRLAARAVQLRYWLAGLFAAAIVIAIIFTTLQTPLFRSTAQIEISRVEISAGDS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDLAAAGQENRDQQYFNTQYELLRSRAVATRVVDALDLSEDEQFASAYSADPGQISPERAASLILGSVEILPIPQSNLVD
GDLAAAGQENRDQQYFNTQYELLRSRAVATRVVDALDLSEDEQFASAYSADPGQISPERAASLILGSVEILPIPQSNLVD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAVSSPSADLSARLANAWAEQFLELNYEKRFGDNILARELVEDQLAEMRVQLEEAEERLSAYASANEILVVESTGEDGNT
IAVSSPSADLSARLANAWAEQ                                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQSTILARQLSAVNEALAAATVNRIAAASAVQSSNTPTTNGQSALRGRLADVESQLASARTTLGPQHPQVRALEAQQETL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRALNGADGEASTQLANALQQAVLEERRLQDRFNSLRSQYLSQQGQGAQYGILEREVDTNRQIYAALLQRYNQLGVAGSG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNNMTLIENARPAPGPYSPNMPLNIAIAVLASLLIGAGVVYAVELLDQSIRDPEDVQRQFGLPLLGLIPKSTDGEVHEEV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LERSSSTGEAYASARFALQHLDNADQLRTLMLTSARPGEGKTSSSLALAKSFADMGEKVVLVDFDLRRRGVSRLLGPAAS
                                TSARPGEGKTSSSLALAKSFADMGEKVVLVDFDLRRRGVSRLLGPAAS
                                       GKT                 VLVDFDLR             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRGMLGFLKGSTPEPTFHSLTDYGVDFVGTSDIEREPVSLLTRPRIGALMNLLQSRYDRIVIDAPPVLGLADSVELAQSV
DRGMLGFLKGSTPEPTFHSLTDYGVDFVGTSDIEREPVSLLTRPRIGALMNLLQSRYDRIVIDAPPVLGLADSVELAQSV
                                                           IVIDAPP              
       650       660       670       680       690       700 
....:....|....:....|....:....|....:....|....:....|....:....|.
DGVVFVIEANVGSANAVRRALSRLRDANAPLLGSFVTKLDQRNALYGYGGDYGYGYSYSQS
DGVVFVIEANVGSANAVRRALSRLRDANAPLLGSFVTKLDQRNALYGYGGDYGYGYSYSQ 
                                             YGYGGDYGYGYSY   

© 1998-2019