BYKdb

Annotate results for A0A0G9MZA5

A0A0G9MZA5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0G9MZA5
DOMAINcd397/587TSSQPGEGKSLTAVAIAYLLARQGKKVLLVDVDLRKSGVGKYLSIDTAQGMSQYHMGKDD
WRSMVLPSTPLEDFHVIPAGRKPLSAAELLSSGRFQRMLDEAEAEYDHVVIDAPPVLGLV
DAPMIAPSLDGVVLVIEANGGKWRHLESAVSRLRASNAELLGAAVTKLDERNAMYGYGYG
YGYGYGYGHDR
SITEWalker A404/406GKS
SITEWalker A'424/431LLVDVDLR
SITEWalker B505/511VVIDAPP
SITEY Cluster571/583YGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPENADIEPALAGTLLNNVSITPIINSTLVDISFSSPDPQVSARIANAWADAYIAENLDRRFGATRDARSSLEEQLQQYR


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRLEEAERAVIAYATAQGLVSIDVPREDGDSAGTASQTLVATELAAFNSALQQATTQRIAAEAALAARSGANAGSTEASA


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TADALRARRAELQVELAELRSRFSPSYPPVQALQVQIDELERAIREEQAGAQSGSQSRLRANYNEALAAEQRLQAQVNRL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QANYTDQRQDSVEYNILQREVDTNREIYAGLLQRYREIGVVGVGESNVLVVDPAQVPGGPYTPSLIRNLLIALVAGLVVV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILGLYAYDFLNQTLRDPRQVRDRLGLNLLANIPRIDEGDIVEELQHSYSELYEAYFSLTSSVAFAAGGSMPRSLMITSSQ
                                                                            TSSQ

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PGEGKSLTAVAIAYLLARQGKKVLLVDVDLRKSGVGKYLSIDTAQGMSQYHMGKDDWRSMVLPSTPLEDFHVIPAGRKPL
PGEGKSLTAVAIAYLLARQGKKVLLVDVDLRKSGVGKYLSIDTAQGMSQYHMGKDDWRSMVLPSTPLEDFHVIPAGRKPL
   GKS                 LLVDVDLR                                                 
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAAELLSSGRFQRMLDEAEAEYDHVVIDAPPVLGLVDAPMIAPSLDGVVLVIEANGGKWRHLESAVSRLRASNAELLGAA
SAAELLSSGRFQRMLDEAEAEYDHVVIDAPPVLGLVDAPMIAPSLDGVVLVIEANGGKWRHLESAVSRLRASNAELLGAA
                        VVIDAPP                                                 
       570       580       590        
....:....|....:....|....:....|....:...
VTKLDERNAMYGYGYGYGYGYGYGHDRKKEGEEEGLPA
VTKLDERNAMYGYGYGYGYGYGYGHDR           
          YGYGYGYGYGYGY               
© 1998-2019