BYKdb

Annotate results for A0A0H0ZWI3

A0A0H0ZWI3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0H0ZWI3
DOMAINtad23/214DLIDIERLLRMALRQAKVVIVCAVIGLLLGVVYLQTTPPKYTAVARVLIDEGLSRITEDA
ETTPLNMQSDGAVLSQIEILTSSRLAGNVVDHLRLTENENFMNPPSSLFGRIVGGLRGLV
GYLRSQPEANDGDYDAETLAAMKAAATRQYAIELLQKNVVANRVGRTFVVAVAYQSHDPQ
LAAEITNAYADA
DOMAINcd587/778VSVLPGEGKSTVASNLAELLALNNSRTLLIDADLRNPGLTRGLGIRSEAGLMEAVVNLQN
WRSLLKHDRQTNLAILPAVVRGQFSHTSELLSSPGMHQLIEQARESFEHIIVDLPPLGPV
VDAKAFEPCADGFVVVVEWGRTPRAVVRSTLASEPRIANKVLGVVLNKVKLASLPRYGSF
GSSEQFLRRYSS
SITEWalker A594/596GKS
SITEWalker A'614/621LLIDADLR
SITEWalker B696/702IIVDLPP
SITEY Cluster776/780YSSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTYASFPFDGKMPAQPPGERNDDLIDIERLLRMALRQAKVVIVCAVIGLLLGVVYLQTTPPKYTAVARVLIDEGLSRITE
                      DLIDIERLLRMALRQAKVVIVCAVIGLLLGVVYLQTTPPKYTAVARVLIDEGLSRITE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAETTPLNMQSDGAVLSQIEILTSSRLAGNVVDHLRLTENENFMNPPSSLFGRIVGGLRGLVGYLRSQPEANDGDYDAET
DAETTPLNMQSDGAVLSQIEILTSSRLAGNVVDHLRLTENENFMNPPSSLFGRIVGGLRGLVGYLRSQPEANDGDYDAET

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAAMKAAATRQYAIELLQKNVVANRVGRTFVVAVAYQSHDPQLAAEITNAYADAYLSHQLDASYEASERATVWLRDRLDE
LAAMKAAATRQYAIELLQKNVVANRVGRTFVVAVAYQSHDPQLAAEITNAYADA                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRAGSQNAALEVEKYRAEHGLSASQGQLLTEQQLTELTGQLIEAQADTAKTQARYQQYKAIVDAGSAEAVGNVAITSDQP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTSTIATLKERYLNVTRREQEITRNYGEDHQQAVALRREQAELTRSIYAQLQQLTESYRNDFEVAQARETALRRTLSDAR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GESAEANQSRVVLRELEQQASALSALYQTFLSRYEETQQKQSFPIAKVRVISEATTPKAATSPRTSMVLGIALILGGMLG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GALGALNEFNERFFRTGEDVRDQLGMKFLGYLPLIGRAEVKGKTPAAPGASPDSKKAERATALMERRARMRVTVDAPASM


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FAESLRNAKIAGDVVLQNSRSKVIGVVSVLPGEGKSTVASNLAELLALNNSRTLLIDADLRNPGLTRGLGIRSEAGLMEA
                          VSVLPGEGKSTVASNLAELLALNNSRTLLIDADLRNPGLTRGLGIRSEAGLMEA
                                 GKS                 LLIDADLR                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVNLQNWRSLLKHDRQTNLAILPAVVRGQFSHTSELLSSPGMHQLIEQARESFEHIIVDLPPLGPVVDAKAFEPCADGFV
VVNLQNWRSLLKHDRQTNLAILPAVVRGQFSHTSELLSSPGMHQLIEQARESFEHIIVDLPPLGPVVDAKAFEPCADGFV
                                                       IIVDLPP                  
       730       740       750       760       770       780       790  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
VVVEWGRTPRAVVRSTLASEPRIANKVLGVVLNKVKLASLPRYGSFGSSEQFLRRYSSYYLDNTETREKEPS
VVVEWGRTPRAVVRSTLASEPRIANKVLGVVLNKVKLASLPRYGSFGSSEQFLRRYSS              
                                                       YSSYY            

© 1998-2019