BYKdb

Annotate results for A0A0H1AN77

A0A0H1AN77 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0H1AN77
DOMAINtad13/271DEIDLRELLGTLIDRKWWIIGITAVFFVASVAYALLATPIYQARSMVQVESKAPTIPGLP
DLSSLGGGVTSTAATTEVALITSRTVIGGAVDTTRADVIVEPARFPLIGGFLARRFSPET
PDQVASPWFGLSRYGWGGEHVEIVGLEVPSVLEGQPLTLRVGDDASRFSLLGPDDELLVE
GTVGADAEGGGVRLQVAALRANPGTRFEVTKLRRLDVVAGYQQDVNASEQGRESGILQLA
FEHPDPQFAEAFLQAVAAA
DOMAINcd559/746SGPRPAVGKTFVSANLAAVIAQAGQRVLVIDADMRKGTLHKVLGVPHAQGLSDVLGGKLD
VAAAIRPADGVENMHYMVRGDIPPNPSELLMHPRFGQLLETLSAQYDLVIVDTPPILAVT
DAAVIARHAGSSLLVTRFGVNQPKEILLTKKRFEQNGVQVKGVIFNAVEKRATGYYSYGY
YEYKADKA
SITEWalker A566/568GKT
SITEWalker A'586/593LVIDADMR
SITEWalker B667/673VIVDTPP
SITEY Cluster733/741YYSYGYYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKETGASPKDEDEIDLRELLGTLIDRKWWIIGITAVFFVASVAYALLATPIYQARSMVQVESKAPTIPGLPDLSSLGGG
            DEIDLRELLGTLIDRKWWIIGITAVFFVASVAYALLATPIYQARSMVQVESKAPTIPGLPDLSSLGGG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTSTAATTEVALITSRTVIGGAVDTTRADVIVEPARFPLIGGFLARRFSPETPDQVASPWFGLSRYGWGGEHVEIVGLEV
VTSTAATTEVALITSRTVIGGAVDTTRADVIVEPARFPLIGGFLARRFSPETPDQVASPWFGLSRYGWGGEHVEIVGLEV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSVLEGQPLTLRVGDDASRFSLLGPDDELLVEGTVGADAEGGGVRLQVAALRANPGTRFEVTKLRRLDVVAGYQQDVNAS
PSVLEGQPLTLRVGDDASRFSLLGPDDELLVEGTVGADAEGGGVRLQVAALRANPGTRFEVTKLRRLDVVAGYQQDVNAS

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQGRESGILQLAFEHPDPQFAEAFLQAVAAAYVRQNVERNSAEAGAQLEFVREQLPTVRLQVEAAQKAMNEYQTRANSVD
EQGRESGILQLAFEHPDPQFAEAFLQAVAAA                                                 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ITMQTQGLLQQEVAVETSIQQLRLQQAEMDRSFTREHPAYRALLKQIGELEARKAGFQKQVGQLPDTQQELLTLTRDLQV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNELYTGLLNQAQQLDVARAGTVGNVRIVDPAVVDTQRPVKPRKSLIVLIGTLLGGFLSVALVFLQKLLNPGIEDPAQIE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELGLPVYAAIPLSQARDLLIMDRLRNRKGRVRRDPGFDKRQHLLAVNAPADLAIEAIRSLRTSLHFAMLEAKNNILAISG
                                                                              SG

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRPAVGKTFVSANLAAVIAQAGQRVLVIDADMRKGTLHKVLGVPHAQGLSDVLGGKLDVAAAIRPADGVENMHYMVRGDI
PRPAVGKTFVSANLAAVIAQAGQRVLVIDADMRKGTLHKVLGVPHAQGLSDVLGGKLDVAAAIRPADGVENMHYMVRGDI
     GKT                 LVIDADMR                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPNPSELLMHPRFGQLLETLSAQYDLVIVDTPPILAVTDAAVIARHAGSSLLVTRFGVNQPKEILLTKKRFEQNGVQVKG
PPNPSELLMHPRFGQLLETLSAQYDLVIVDTPPILAVTDAAVIARHAGSSLLVTRFGVNQPKEILLTKKRFEQNGVQVKG
                          VIVDTPP                                               
       730       740      
....:....|....:....|....:.
VIFNAVEKRATGYYSYGYYEYKADKA
VIFNAVEKRATGYYSYGYYEYKADKA
            YYSYGYYEY     

© 1998-2019