BYKdb

Annotate results for A0A0H1RE96

A0A0H1RE96 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0H1RE96
DOMAINtad24/207DLVDFGFILGAMKRQWLLIALAWFLFAALGVAYIVITPATFYASSSVIIDAKRIDPFRED
SGTASGAIDPGFIESQVATINSIAVVEDVVRRLGLQDDPEFGSGDDPTFNPISHVRAALK
TALQSAGWLPPQPPNSNDPIRIAVEKVKDNLDVHRGGLSYVIAIGFSSLDPEKAALIANA
FSER
DOMAINcd429/619TSCIPHEGKSSVAVNLGHMFSRTGRRTLLIDLDFRFPYLTSALVDNPSRGILDLLESGGS
LDDKLWIDAESGLHVLPGVSGEPEAAAHEMLGSRRMKQLMDDLSAHYDVIVLDMSPIAPS
VDVRAAAHLLDGVVLVVGWNMLTADVLRRTIETSGEIKSKIIGAVLNKVDEKRVRSYDSS
YDESYWVGYYG
SITEWalker A436/438GKS
SITEWalker A'456/463LLIDLDFR
SITEWalker B538/544IVLDMSP
SITEY Cluster605/618YDSSYDESYWVGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNLARNYSIKADYISTKTEAERQDLVDFGFILGAMKRQWLLIALAWFLFAALGVAYIVITPATFYASSSVIIDAKRIDPF
                       DLVDFGFILGAMKRQWLLIALAWFLFAALGVAYIVITPATFYASSSVIIDAKRIDPF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REDSGTASGAIDPGFIESQVATINSIAVVEDVVRRLGLQDDPEFGSGDDPTFNPISHVRAALKTALQSAGWLPPQPPNSN
REDSGTASGAIDPGFIESQVATINSIAVVEDVVRRLGLQDDPEFGSGDDPTFNPISHVRAALKTALQSAGWLPPQPPNSN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DPIRIAVEKVKDNLDVHRGGLSYVIAIGFSSLDPEKAALIANAFSERYIEYQVASRLVGAGRTKDWLEERIEELRSRAAV
DPIRIAVEKVKDNLDVHRGGLSYVIAIGFSSLDPEKAALIANAFSER                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADRAVAQFQPDGGSEAQVRLRELESNAQSYRTLYNNFLDRYARVVQEQSFSGSEARILTRAVPPTQRDAPIISIVMLMAS


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAGLALGTAGAFLREISDRKVKTTRQVESLANCDFLGFLPRFDVGSLDYAATRSVTSKLDGSSVAHHYQPLLSAVIHQPY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRFTETIRNIVVTCNEIGRASRCKVIGVTSCIPHEGKSSVAVNLGHMFSRTGRRTLLIDLDFRFPYLTSALVDNPSRGIL
                            TSCIPHEGKSSVAVNLGHMFSRTGRRTLLIDLDFRFPYLTSALVDNPSRGIL
                                   GKS                 LLIDLDFR                 
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLLESGGSLDDKLWIDAESGLHVLPGVSGEPEAAAHEMLGSRRMKQLMDDLSAHYDVIVLDMSPIAPSVDVRAAAHLLDG
DLLESGGSLDDKLWIDAESGLHVLPGVSGEPEAAAHEMLGSRRMKQLMDDLSAHYDVIVLDMSPIAPSVDVRAAAHLLDG
                                                         IVLDMSP                
       570       580       590       600       610       620    
....:....|....:....|....:....|....:....|....:....|....:....|....
VVLVVGWNMLTADVLRRTIETSGEIKSKIIGAVLNKVDEKRVRSYDSSYDESYWVGYYGPNLKK
VVLVVGWNMLTADVLRRTIETSGEIKSKIIGAVLNKVDEKRVRSYDSSYDESYWVGYYG     
                                            YDSSYDESYWVGYY      
© 1998-2019