BYKdb

Annotate results for A0A0H2SAF7

A0A0H2SAF7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0H2SAF7
DOMAINtad8/164DELTLEDIIHIFKKRFWWFFATVVITVALTILYLFLTTPIYEASVTLKIESQQSSSISDI
FSSQLTSSRPEISTEVELIKSRTNIEKVIDDLNLVEYFKNKTDDEKTKKEINKYNIIKTL
SEMITVSPVKDTNIVKISVQSDDPEMAKKIANKLAEV
DOMAINcd527/716TSAGPGEGKTITSANLAISYAQNGLKTLLIDIDMRKPRVEKALGLERFNIGLVNHILKNV
PIERITQNYMENLDVIPVGPLPPNPTALLTSKQFGELINTLKEKYDKIIVDLPPILAAAD
ALIVSKHTDGLILVVRAGKTQKHSLKIALENVITSDNTLLGLIIDDINEKNSGYYYYYYY
YYEDGQKKKR
SITE-664/-666GKT
SITEWalker A'554/561LLIDIDMR
SITEWalker B634/640IIVDLPP
SITEY Cluster700/708YYYYYYYYY
SITEWalker A534/536GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDPEIYEDELTLEDIIHIFKKRFWWFFATVVITVALTILYLFLTTPIYEASVTLKIESQQSSSISDIFSSQLTSSRPEIS
       DELTLEDIIHIFKKRFWWFFATVVITVALTILYLFLTTPIYEASVTLKIESQQSSSISDIFSSQLTSSRPEIS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEVELIKSRTNIEKVIDDLNLVEYFKNKTDDEKTKKEINKYNIIKTLSEMITVSPVKDTNIVKISVQSDDPEMAKKIANK
TEVELIKSRTNIEKVIDDLNLVEYFKNKTDDEKTKKEINKYNIIKTLSEMITVSPVKDTNIVKISVQSDDPEMAKKIANK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAEVYNEFLKTLSKNEYTVKREFIEKQIPKVENDLKAAEEKIRKFKEENKVFLLDEEAKNILSFTLEYDKQINSYNLQLE
LAEV                                                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETKAKVRAFNDLLKKVDEKIISSETISTNPFINQLKSKLINYKVELAGLTNIYSETDPKVKEIKDKIAETEKLLKEQVTK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVTSQVKTINPAYQDIYLQLIESQYTTEVIKSTIQALTKLKETYNQKFAKLPLLEQQLLELQRDIKVKENLYTLLLEKLE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETRIAEAGVIGTAKLIDSAITPDKPIKPNKKLTAAIGGVLGIFLGILVAFIIEYADKSIKDEEEIKRMAKGKTILGRIPT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FEMKKEYSNPELIVLNEPISPVAESIKLTSANINYSVTPEPKVIAVTSAGPGEGKTITSANLAISYAQNGLKTLLIDIDM
                                              TSAGPGEGKTITSANLAISYAQNGLKTLLIDIDM
                                                     GKT                 LLIDIDM
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPRVEKALGLERFNIGLVNHILKNVPIERITQNYMENLDVIPVGPLPPNPTALLTSKQFGELINTLKEKYDKIIVDLPP
RKPRVEKALGLERFNIGLVNHILKNVPIERITQNYMENLDVIPVGPLPPNPTALLTSKQFGELINTLKEKYDKIIVDLPP
R                                                                        IIVDLPP
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILAAADALIVSKHTDGLILVVRAGKTQKHSLKIALENVITSDNTLLGLIIDDINEKNSGYYYYYYYYYEDGQKKKRKKNK
ILAAADALIVSKHTDGLILVVRAGKTQKHSLKIALENVITSDNTLLGLIIDDINEKNSGYYYYYYYYYEDGQKKKR    
                                                           YYYYYYYYY            
    
....
KNKN


© 1998-2019