BYKdb

Annotate results for A0A0H2V0J1

A0A0H2V0J1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0H2V0J1
DOMAINtad28/264DEIDIGRLVGTVIEARWWVIGITVVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQD
IGSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNET
VKVTTFNRPKEMADQVFTLNVLDDKNYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHAR
PGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDREQIRDILNSIARN
DOMAINcd544/731TGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGD
ITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILAVTD
AAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYY
EYEYKSDA
SITEWalker A551/553GKT
SITEWalker A'571/578LLIDCDMR
SITEWalker B651/657VLIDTPP
SITEY Cluster717/727YQDYGYYEYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGAGIERRAGIRMTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITVVFALCAVVYTFFATPIYSADALVQIEQNS
                           DEIDIGRLVGTVIEARWWVIGITVVFALCAVVYTFFATPIYSADALVQIEQNS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GNSLVQDIGSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMA
GNSLVQDIGSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DQVFTLNVLDDKNYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAG
DQVFTLNVLDDKNYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLSLTYTGEDREQIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKA
VLSLTYTGEDREQIRDILNSIARN                                                        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDSMVNIDAQLNELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKNQQEIVRLTRDVESGQQVYMQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLNKEQELKITEASTVGDVRIIDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIPLSEWQKARDSVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLA
                                                               TGVSPSIGKTFVCANLA
                                                                      GKT       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAEL
AVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAEL
          LLIDCDMR                                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDY
VNWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDY
          VLIDTPP                                                           YQDY
       730  
....:....|..
GYYEYEYKSDAK
GYYEYEYKSDA 
GYYEYEY     

© 1998-2019