BYKdb

Annotate results for A0A0H3J709

A0A0H3J709 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0H3J709
DOMAINcd38/224TSSTPSEGKSTVSSNLALAMAETNKKVLLIDCDLRRPSIHKKFGLSNEKGLSNLLIGQHS
FNEIAQEITSNLCVLTSGTIPPNPSEMLSSKKMELFLKEAEKNFDFIILDTPPVVSVTDA
QALSTIVDGVLLVVSSGHAQIPEVHKAIELLQYVKANIIGIVANKVKSFRRGYKYYQYYY
YGEGDGK
SITEWalker A45/47GKS
SITEWalker A'65/72LLIDCDLR
SITEWalker B144/150IILDTPP
SITEY Cluster210/218YKYYQYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIVKDNPKSPISESYRTLRTNIQFSSFDDNMSTILVTSSTPSEGKSTVSSNLALAMAETNKKVLLIDCDLRRPSIHKKF
                                     TSSTPSEGKSTVSSNLALAMAETNKKVLLIDCDLRRPSIHKKF
                                            GKS                 LLIDCDLR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLSNEKGLSNLLIGQHSFNEIAQEITSNLCVLTSGTIPPNPSEMLSSKKMELFLKEAEKNFDFIILDTPPVVSVTDAQAL
GLSNEKGLSNLLIGQHSFNEIAQEITSNLCVLTSGTIPPNPSEMLSSKKMELFLKEAEKNFDFIILDTPPVVSVTDAQAL
                                                               IILDTPP          
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
STIVDGVLLVVSSGHAQIPEVHKAIELLQYVKANIIGIVANKVKSFRRGYKYYQYYYYGEGDGKNKKHRSKSSK
STIVDGVLLVVSSGHAQIPEVHKAIELLQYVKANIIGIVANKVKSFRRGYKYYQYYYYGEGDGK          
                                                 YKYYQYYYY                
© 1998-2019