BYKdb

Annotate results for A0A0H4KZM1

A0A0H4KZM1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0H4KZM1
DOMAINcd172/356TSPTEGCGKTFLAANLAISLSRQSNCRSVLLDLDMRHPTLDKVLNIPDAPDLPAFLRGNL
PLGDLLRRPAANDFKIGDQVAFGVNARREPYAAELLQDPDTAAVLSGMEAALAPDVVLFD
MPPALVNDDVLAARPLFDGIILVVGGGITKPQQVRDVERRLGTETPLLGVVLNRSEGEAA
QIYSY
SITEWalker A179/181GKT
SITEWalker A'200/207VLLDLDMR
SITEWalker B288/294VLFDMPP
SITEY Cluster354/356YSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKRWTRKKRASREAGGPAPKPALTGPIHLAPERETPLEPEELTPPETPTTADVRSEAERTSEAAPSPEAKPRAPAKDAR


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAVAPPEPAPAPAVEAPEPDQPTEPAPPPRRNRGEPGAWAALPSFHVNARKLERNRIITATREDPVHSAFDVLRTKLLRA


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRENGWTRVAITSPTEGCGKTFLAANLAISLSRQSNCRSVLLDLDMRHPTLDKVLNIPDAPDLPAFLRGNLPLGDLLRRP
           TSPTEGCGKTFLAANLAISLSRQSNCRSVLLDLDMRHPTLDKVLNIPDAPDLPAFLRGNLPLGDLLRRP
                  GKT                  VLLDLDMR                                 
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AANDFKIGDQVAFGVNARREPYAAELLQDPDTAAVLSGMEAALAPDVVLFDMPPALVNDDVLAARPLFDGIILVVGGGIT
AANDFKIGDQVAFGVNARREPYAAELLQDPDTAAVLSGMEAALAPDVVLFDMPPALVNDDVLAARPLFDGIILVVGGGIT
                                               VLFDMPP                          
       330       340       350      
....:....|....:....|....:....|....:.
KPQQVRDVERRLGTETPLLGVVLNRSEGEAAQIYSY
KPQQVRDVERRLGTETPLLGVVLNRSEGEAAQIYSY
                                 YSY
© 1998-2019