BYKdb

Annotate results for A0A0H4LEI8

A0A0H4LEI8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0H4LEI8
DOMAINcd58/249TSSAPSEGKSTVSNNVAVTWAKQGDKVILIDADLRRPTMHKTFNLSNKFGLSNYLLGNAE
LEDVVQKTMVDNLYVITSGPIPPNPSELLGSMRTKDLLVRLADKFDLLILDAPPANSVTD
AQVLATKVDGVVLVVPQGIAEKSGVAHAQQALETVHANILGFVMNRVIRESTGYYGGYYG
GHYGGYYGADKK
SITEWalker A65/67GKS
SITEWalker A'85/92ILIDADLR
SITEWalker B165/171LILDAPP
SITEY Cluster231/244YYGGYYGGHYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKLFKSKRKKLDNYSLKHGVGLISYDDPTSTVSEQFKTIRTNIQFSSVDKKLKSILFTSSAPSEGKSTVSNNVAVTWAKQ
                                                         TSSAPSEGKSTVSNNVAVTWAKQ
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDKVILIDADLRRPTMHKTFNLSNKFGLSNYLLGNAELEDVVQKTMVDNLYVITSGPIPPNPSELLGSMRTKDLLVRLAD
GDKVILIDADLRRPTMHKTFNLSNKFGLSNYLLGNAELEDVVQKTMVDNLYVITSGPIPPNPSELLGSMRTKDLLVRLAD
    ILIDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KFDLLILDAPPANSVTDAQVLATKVDGVVLVVPQGIAEKSGVAHAQQALETVHANILGFVMNRVIRESTGYYGGYYGGHY
KFDLLILDAPPANSVTDAQVLATKVDGVVLVVPQGIAEKSGVAHAQQALETVHANILGFVMNRVIRESTGYYGGYYGGHY
    LILDAPP                                                           YYGGYYGGHY
         
....:....
GGYYGADKK
GGYYGADKK
GGYY     
© 1998-2019