BYKdb

Annotate results for A0A0H4TUX7

A0A0H4TUX7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0H4TUX7
DOMAINtad44/266REVHLRDLVGVVSRHWRLVALLTVLVAGGAWYSARRQVPRYQSRLTVQVSSPKQVFAQLE
GMRVDELALQTDPVLSEALILTTQQLALEVVRGLALHLELDDPGLRRGDLFAAVAVDSTT
PPGAYRLTVQPTSGFEVRDGFGTVVAQGQPGETVVGPGFTLRLVPSPEARTVGFRLVRPE
EAAAWVSGGLSYNVREGTNAVDISFAGTDPTLVPQILNAAAVA
DOMAINcd611/799TSPGPGEGKSTTAVNLAVALAQGGQRTLLIDGDLRRPLIHRAFALVQEPGLTDVLVGRAT
AREAVRPDAAPGLDVLPSGSIPPNPSELLGSAAMHSLISALRRDYHYIIIDTPPTLPVTD
ASVVASGADAAILVLRSGDTQETAAQRALEQLRRVHARIAGAVLNGVSSRHDRYYTYYSY
RREPARRGL
SITEWalker A618/620GKS
SITEWalker A'638/645LLIDGDLR
SITEWalker B718/724IIIDTPP
SITE-715/-717YHY
SITEY Cluster784/790YYTYYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNLRSGTWSHSLSFLSSATTWENRLDAVRRPEGTEALRRIVHQREVHLRDLVGVVSRHWRLVALLTVLVAGGAWYSARRQ
                                           REVHLRDLVGVVSRHWRLVALLTVLVAGGAWYSARRQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPRYQSRLTVQVSSPKQVFAQLEGMRVDELALQTDPVLSEALILTTQQLALEVVRGLALHLELDDPGLRRGDLFAAVAVD
VPRYQSRLTVQVSSPKQVFAQLEGMRVDELALQTDPVLSEALILTTQQLALEVVRGLALHLELDDPGLRRGDLFAAVAVD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STTPPGAYRLTVQPTSGFEVRDGFGTVVAQGQPGETVVGPGFTLRLVPSPEARTVGFRLVRPEEAAAWVSGGLSYNVREG
STTPPGAYRLTVQPTSGFEVRDGFGTVVAQGQPGETVVGPGFTLRLVPSPEARTVGFRLVRPEEAAAWVSGGLSYNVREG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TNAVDISFAGTDPTLVPQILNAAAVALRLDGVRRAQEIAARKRTYVAEQLAKADSSYRIKLAELQRFKEGEQITDLSVEE
TNAVDISFAGTDPTLVPQILNAAAVA                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSVVQSIQALEQQRQQITVQIATLREALGQPGDSIGVGTLNRLAAVQDIGQNTALGFQIQNLLTLYDQRRTLTAGALGLR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERNPQVDALSERIRQGYQALRGAVSAALESLESRTEALDQRVASARARLRTFPGKESRIAQLQLEASILNDTYRYLLTEY


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESARLTEATIGPYINLLDPASPAFRVGTTLRQKIVLGMLVGLLLGLGGAFFLEYLDQTIKNAGDVERVIGVPVLGLIPHD


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PALRRSGNGKPPITIVAREGMDQPAAEAFRALRTNVTFVGAEKPLQFMSVTSPGPGEGKSTTAVNLAVALAQGGQRTLLI
                                                  TSPGPGEGKSTTAVNLAVALAQGGQRTLLI
                                                         GKS                 LLI
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGDLRRPLIHRAFALVQEPGLTDVLVGRATAREAVRPDAAPGLDVLPSGSIPPNPSELLGSAAMHSLISALRRDYHYIII
DGDLRRPLIHRAFALVQEPGLTDVLVGRATAREAVRPDAAPGLDVLPSGSIPPNPSELLGSAAMHSLISALRRDYHYIII
DGDLR                                                                        III
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTPPTLPVTDASVVASGADAAILVLRSGDTQETAAQRALEQLRRVHARIAGAVLNGVSSRHDRYYTYYSYRREPARRGLL
DTPPTLPVTDASVVASGADAAILVLRSGDTQETAAQRALEQLRRVHARIAGAVLNGVSSRHDRYYTYYSYRREPARRGL 
DTPP                                                           YYTYYSY          
       810       820    
....:....|....:....|....
TAGSPRAGGCSPFGRSSAIPSENQ


© 1998-2019