BYKdb

Annotate results for A0A0H4V9K9

A0A0H4V9K9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0H4V9K9
DOMAINtad25/194SFFTFATIRGILWRQRFIIIGAVALALLAALIITLLTRPIYQASSTVVYQPPGTSIIEGQ
DLEPYISTNEVARHMETLAGVVVSRSMAMSVVDNLNLYDSEELLGEMLEQGRPQNMTEEA
WLDQRRNAAAGILRGGVSAQTPYDVRIMTINFASTDPRLAARIATGYADT
DOMAINcd539/729TSAEVGEGKSTTSIALAQRYAAVGKKTLLVDMDLRRPALARRLGITKNKSAGLIDALFKR
APLDSAIIKGADGGFDLLPISERPDSPISVLSSGLVPELLAQLRLKYDTIIVDSSPLLGL
ADAPMLARYVDAVLLIVEANRSRAAQTRATIRRLGEVGVEPAGIVLTKFKSLEAGQSYDY
KYRYYEYKADD
SITEWalker A546/548GKS
SITEWalker A'566/573LLVDMDLR
SITEWalker B648/654IIVDSSP
SITEY Cluster716/725YDYKYRYYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVDRYLPQDTAVESPNGAYGTASRSFFTFATIRGILWRQRFIIIGAVALALLAALIITLLTRPIYQASSTVVYQPPGTSI
                        SFFTFATIRGILWRQRFIIIGAVALALLAALIITLLTRPIYQASSTVVYQPPGTSI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEGQDLEPYISTNEVARHMETLAGVVVSRSMAMSVVDNLNLYDSEELLGEMLEQGRPQNMTEEAWLDQRRNAAAGILRGG
IEGQDLEPYISTNEVARHMETLAGVVVSRSMAMSVVDNLNLYDSEELLGEMLEQGRPQNMTEEAWLDQRRNAAAGILRGG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSAQTPYDVRIMTINFASTDPRLAARIATGYADTFVQRGISDTSETNEFAREFLQKQIAEIREELRSREIENNSYARSNG
VSAQTPYDVRIMTINFASTDPRLAARIATGYADT                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIAMPDPVGSEDGANSGQTQTLTATNLASINATFTQARVARIEAEERWRAVENVPAGRIPEVQASGAVQAQRAQLATMRG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLSDLSQRYQDEYPPLQELRAQIETTQSQLQTTENEIKQSLRSAYRIALQQEQALGEEVSRVSDEALNEQDRRVQLSLLD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REASALRDQLASLLARYNQLSAASTLQTSSLTKLDPASVPSSPSSPNLLRNLIAGLAAGLALAGGLAVLRETLDDKLYSI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDIETRIGVKALGQTPHITENLDDALENPFSILSEAYSSIRATLDYNVLRDGKEIIQITSAEVGEGKSTTSIALAQRYAA
                                                          TSAEVGEGKSTTSIALAQRYAA
                                                                 GKS            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGKKTLLVDMDLRRPALARRLGITKNKSAGLIDALFKRAPLDSAIIKGADGGFDLLPISERPDSPISVLSSGLVPELLAQ
VGKKTLLVDMDLRRPALARRLGITKNKSAGLIDALFKRAPLDSAIIKGADGGFDLLPISERPDSPISVLSSGLVPELLAQ
     LLVDMDLR                                                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRLKYDTIIVDSSPLLGLADAPMLARYVDAVLLIVEANRSRAAQTRATIRRLGEVGVEPAGIVLTKFKSLEAGQSYDYKY
LRLKYDTIIVDSSPLLGLADAPMLARYVDAVLLIVEANRSRAAQTRATIRRLGEVGVEPAGIVLTKFKSLEAGQSYDYKY
       IIVDSSP                                                             YDYKY
         
....:....
RYYEYKADD
RYYEYKADD
RYYEY    

© 1998-2019