BYKdb

Annotate results for A0A0H5SF45

A0A0H5SF45 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0H5SF45
DOMAINtad1/136MELSIKDVLGIIYKRLIFIIACTFFCAIMSYVYNKFIKDPVYTASVQFCVNTNDNSSGNI
NELNYAQKVVSTYVNLLRTNTFYRQVLEATGLNYSVQQLKAMTQISSVNDTEIFQITLSS
NSADDAYTLVEAMQKI
DOMAINcd285/471NSPNPRDGKSTTCTNIAIALAKTGARVLLIDCDLRKGRLHVPFNLNSTPGVTNLLSGMNT
EKETIQYTSYNNLQIIPCGSIAPNPTELLSSIQMEELIKKLEQNYDYIIIDTAPVNLVAD
ALSLAKMVDGVLMVVREKSTTYPHVETALNKYELIGGNILGFVLNGSALTQENKSKSSYY
YYQRNND
SITEWalker A292/294GKS
SITEWalker A'312/319LLIDCDLR
SITEWalker B392/398IIIDTAP
SITE-351/-391YTSYNNLQIIPCGSIAPNPTELLSSIQMEELIKKLEQNYDY
SITEY Cluster463/466YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELSIKDVLGIIYKRLIFIIACTFFCAIMSYVYNKFIKDPVYTASVQFCVNTNDNSSGNINELNYAQKVVSTYVNLLRTN
MELSIKDVLGIIYKRLIFIIACTFFCAIMSYVYNKFIKDPVYTASVQFCVNTNDNSSGNINELNYAQKVVSTYVNLLRTN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TFYRQVLEATGLNYSVQQLKAMTQISSVNDTEIFQITLSSNSADDAYTLVEAMQKIAPQLIANIKENSKISVVDPVVYPA
TFYRQVLEATGLNYSVQQLKAMTQISSVNDTEIFQITLSSNSADDAYTLVEAMQKI                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPSGPNIYLNTILGAVAGLVLAIAISFFWELIDVKIKSKEDLTKRYQIPILGVIPDFGVKMPKRYLLMQKLPFKNRLNEI


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKDKVEFNQVKNQEANFLVNEAYKALRTNLLYTIRKNGCKKILVNSPNPRDGKSTTCTNIAIALAKTGARVLLIDCDLRK
                                            NSPNPRDGKSTTCTNIAIALAKTGARVLLIDCDLRK
                                                   GKS                 LLIDCDLR 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRLHVPFNLNSTPGVTNLLSGMNTEKETIQYTSYNNLQIIPCGSIAPNPTELLSSIQMEELIKKLEQNYDYIIIDTAPVN
GRLHVPFNLNSTPGVTNLLSGMNTEKETIQYTSYNNLQIIPCGSIAPNPTELLSSIQMEELIKKLEQNYDYIIIDTAPVN
                                                                       IIIDTAP  
       410       420       430       440       450       460       470 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
LVADALSLAKMVDGVLMVVREKSTTYPHVETALNKYELIGGNILGFVLNGSALTQENKSKSSYYYYQRNND
LVADALSLAKMVDGVLMVVREKSTTYPHVETALNKYELIGGNILGFVLNGSALTQENKSKSSYYYYQRNND
                                                              YYYY     
© 1998-2019