BYKdb

Annotate results for A0A0H5SXP8

A0A0H5SXP8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0H5SXP8
DOMAINcd39/229TSCIPNEGKSNVSFNLARSLAEFGKKVIFIDADLRRSVLVGKYKPDQAVIGLSHYLSGQN
SIDEILYETNIDNLDIIFTGPVPPNPAELLGIDIFGELLRIFRKVYDYIIIDTPPIGSVI
DSAIVAQKCDGVILVIEANAISYKLAQRAIRQLNKSKSKILGAVLNKYDYGSRYYGYESK
KYKKYLDYYTE
SITEWalker A46/48GKS
SITEWalker A'66/73IFIDADLR
SITEWalker B147/153IIIDTPP
SITE-144/-146YDY
SITEY Cluster206/230YDYGSRYYGYESKKYKKYLDYYTEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQINFTNINKLSFRANEAYKTLRTNIQFCGNDIKTICITSCIPNEGKSNVSFNLARSLAEFGKKVIFIDADLRRSVLVGK
                                      TSCIPNEGKSNVSFNLARSLAEFGKKVIFIDADLRRSVLVGK
                                             GKS                 IFIDADLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YKPDQAVIGLSHYLSGQNSIDEILYETNIDNLDIIFTGPVPPNPAELLGIDIFGELLRIFRKVYDYIIIDTPPIGSVIDS
YKPDQAVIGLSHYLSGQNSIDEILYETNIDNLDIIFTGPVPPNPAELLGIDIFGELLRIFRKVYDYIIIDTPPIGSVIDS
                                                                  IIIDTPP       
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIVAQKCDGVILVIEANAISYKLAQRAIRQLNKSKSKILGAVLNKYDYGSRYYGYESKKYKKYLDYYTEY
AIVAQKCDGVILVIEANAISYKLAQRAIRQLNKSKSKILGAVLNKYDYGSRYYGYESKKYKKYLDYYTE 
                                             YDYGSRYYGYESKKYKKYLDYYTEY
© 1998-2019