BYKdb

Annotate results for A0A0H6F257

A0A0H6F257 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0H6F257
DOMAINcd95/284TSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQS
LEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSD
SFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYH
YQAYYGEETK
SITEWalker A102/104GKT
SITEWalker A'121/128LLIDCDLR
SITEWalker B202/208IVIDTPP
SITEY Cluster269/279YSGYYHYQAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIVLLAFVVSFGFACVVAFIADAMTDTFADIKQVEKQLALSLLGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSY


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLAHVNQDQHVVMLTSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVY
              TSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVY
                     GKT                LLIDCDLR                                
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVR
HDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVR
                                         IVIDTPP                                
       250       260       270       280         
....:....|....:....|....:....|....:....|....:....
EVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEETKSGAAK
EVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEETK     
                            YSGYYHYQAYY          
© 1998-2019