BYKdb

Annotate results for A0A0H6GCF1

A0A0H6GCF1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0H6GCF1
DOMAINcd23/212TSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQS
LEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSD
SFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYH
YQAYYGEETK
SITEWalker A30/32GKT
SITEWalker A'49/56LLIDCDLR
SITEWalker B130/136IVIDTPP
SITEY Cluster197/207YSGYYHYQAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGT
                      TSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGT
                             GKT                LLIDCDLR                        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDAN
QSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDAN
                                                 IVIDTPP                        
       170       180       190       200       210       
....:....|....:....|....:....|....:....|....:....|....:..
HTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEETKSGAAK
HTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEETK     
                                    YSGYYHYQAYY          
© 1998-2019