BYKdb

Annotate results for A0A0H6V1F7

A0A0H6V1F7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0H6V1F7
DOMAINcd209/398TSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQS
LEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSD
SFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYH
YQAYYGEETK
SITEWalker A216/218GKT
SITEWalker A'235/242LLIDCDLR
SITEWalker B316/322IVIDTPP
SITEY Cluster383/393YSGYYHYQAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKSASAQLEAVRKNLRAELRQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKNAKYSELKREVQTNRELFDLFLA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQKETSASGDFNTTIARFTDQASAPLTPSKPNKKLIVLLAFVVSFGFACVVAFIADAMTDTFADIKQVEKQLALSLLGVV


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLALSLAQMEKTLLIDCD
                                                TSCLPGEGKTTSSLNLALSLAQMEKTLLIDCD
                                                       GKT                LLIDCD
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDT
LRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDT
LR                                                                         IVIDT
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEETKSG
PPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEETK  
PP                                                            YSGYYHYQAYY       
   
...
AAK


© 1998-2019