BYKdb

Annotate results for A0A0H6VVE6

A0A0H6VVE6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0H6VVE6
DOMAINtad10/197EVIDIRQYFNVLLNYKWRILLFSVMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIE
EVYGLDTKSQEYYLTQIEILKSDTIAQEVIERLDLASDPEFDLSPESDASPSLKERLVEW
MPFLQGFKQEETVADPDLEAYRQNRLILYKFKRGMEISPIRKTQLVNIYYTAGDPKLAAK
IANEIARV
DOMAINcd551/747TSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDLRKPAIAXXXXXXXXRFGISGSQPGVTN
LLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTP
PCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKAS
RYSGYYHYQAYYGEETK
SITEWalker A558/560GKT
SITEWalker A'577/584LLIDCDLR
SITEWalker B665/671IVIDTPP
SITEY Cluster732/742YSGYYHYQAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTGKQFTQEEVIDIRQYFNVLLNYKWRILLFSVMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIEEVYGLDTKSQE
         EVIDIRQYFNVLLNYKWRILLFSVMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIEEVYGLDTKSQE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YYLTQIEILKSDTIAQEVIERLDLASDPEFDLSPESDASPSLKERLVEWMPFLQGFKQEETVADPDLEAYRQNRLILYKF
YYLTQIEILKSDTIAQEVIERLDLASDPEFDLSPESDASPSLKERLVEWMPFLQGFKQEETVADPDLEAYRQNRLILYKF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRGMEISPIRKTQLVNIYYTAGDPKLAAKIANEIARVYMDSHLEAKLEVELKANTWLNTRMEELRTQLRESEAKLQAFLQ
KRGMEISPIRKTQLVNIYYTAGDPKLAAKIANEIARV                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEGLVDVQGVEGLATQELEELTSQMNKAXXXXXXXXXXXXVAAETLYQVANSYSKNDSDLTALSSIPEISNHPTIRDLKV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEVDAERKVSEFSKRYGPKHPKLKSASAQLEAVRKNLRAELRQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKYSELKREVQTNRELFDLFLARQKETSASGDFNTTIARFTDQASAPLTPSKPNKKLIVLLAFVVSFGFACVVAFIADAM


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDTFADIKQVEKQLALSLLGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKT
                                                                      TSCLPGEGKT
                                                                             GKT
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSSLNLALSLAQMEKTLLIDCDLRKPAIAXXXXXXXXRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYAS
TSSLNLALSLAQMEKTLLIDCDLRKPAIAXXXXXXXXRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYAS
                LLIDCDLR                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVI
NPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVI
                        IVIDTPP                                                 
       730       740       750  
....:....|....:....|....:....|..
LNRLNAKKASRYSGYYHYQAYYGEETKSGAAK
LNRLNAKKASRYSGYYHYQAYYGEETK     
           YSGYYHYQAYY          

© 1998-2019