BYKdb

Annotate results for A0A0H6WI56

A0A0H6WI56 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0H6WI56
DOMAINcd48/237TSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQS
LEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSD
SFMLAQYVDSVILVIDANHTRTPVVRDVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYH
YQAYYGEETK
SITEWalker A55/57GKT
SITEWalker A'74/81LLIDCDLR
SITEWalker B155/161IVIDTPP
SITEY Cluster222/232YSGYYHYQAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDL
                                               TSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDL
                                                      GKT                LLIDCDL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTP
RKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTP
R                                                                         IVIDTP
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PCLAVSDSFMLAQYVDSVILVIDANHTRTPVVRDVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEETKSGA
PCLAVSDSFMLAQYVDSVILVIDANHTRTPVVRDVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEETK   
P                                                            YSGYYHYQAYY        
  
..
AK


© 1998-2019