BYKdb

Annotate results for A0A0H7B811

A0A0H7B811 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0H7B811
DOMAINcd53/242TSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQS
LEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSD
SFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYH
YQAYYGEETK
SITEWalker A60/62GKT
SITEWalker A'79/86LLIDCDLR
SITEWalker B160/166IVIDTPP
SITEY Cluster227/237YSGYYHYQAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLALSLAQMEKTLL
                                                    TSCLPGEGKTTSSLNLALSLAQMEKTLL
                                                           GKT                LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDCDLRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRI
IDCDLRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRI
IDCDLR                                                                         I
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEE
VIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEE
VIDTPP                                                            YSGYYHYQAYY   
       
....:..
TKSGAAK
TK     

© 1998-2019