BYKdb

Annotate results for A0A0I1Z5N6

A0A0I1Z5N6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0I1Z5N6
DOMAINcd12/201TGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDE
LNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSD
AAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYN
YYGYSYSEKE
SITEWalker A19/21GKT
SITEWalker A'39/46LFIDADLR
SITEWalker B119/125VIVDTPP
SITEY Cluster186/197YSYGYNYYGYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFG
           TGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFG
                  GKT                 LFIDADLR                                  
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSM
KGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSM
                                      VIVDTPP                                   
       170       180       190       200 
....:....|....:....|....:....|....:....|.
QRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
QRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
                         YSYGYNYYGYSY    
© 1998-2019