BYKdb

Annotate results for A0A0J0H0Q7

A0A0J0H0Q7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J0H0Q7
DOMAINtad17/253HEVDLVRLLVEMIDHRTMILCVTFLFTLCAGLYAWVTPPVYQADAMVQIESKQDNSLLKG
LSQLGTDVSPDVAPEILLLKSRMILGETVDKLGLTQQAKQRVLPVVGRLWQRLQGRGQGK
ITLGELQIPQVEGKAQGLTLTVQEAGKYHLTGENIEADGRVGKTLVTQGIVLLVTSIEAT
PGTQFSLKSLTRLETINALKKSLTVAESEKQSGIVTLTLTGEDPDNIARVLNAIADN
DOMAINcd538/727SGPTQDCGKTLVATNLAAVAGQSGQRVLFIDADMRQGYVHNIFGLENRYGLSCLLEGKCD
CTEVIQHAEKAGIDVITCGPEPLRPLELLLSERFLDIMSWVNEQYDIVIIDTPPVLAVTD
ASLVARAAGTTLMVARFDKTSVKEMENTVKRLQHVGVKVSGTILNDIVKSAALFYSSGYS
QCDYGYASKK
SITEWalker A545/547GKT
SITEWalker A'565/572LFIDADMR
SITEWalker B645/651VIIDTPP
SITEY Cluster712/723YSSGYSQCDYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSYTTDNYGAAAPQQHEVDLVRLLVEMIDHRTMILCVTFLFTLCAGLYAWVTPPVYQADAMVQIESKQDNSLLKGLSQL
                HEVDLVRLLVEMIDHRTMILCVTFLFTLCAGLYAWVTPPVYQADAMVQIESKQDNSLLKGLSQL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTDVSPDVAPEILLLKSRMILGETVDKLGLTQQAKQRVLPVVGRLWQRLQGRGQGKITLGELQIPQVEGKAQGLTLTVQE
GTDVSPDVAPEILLLKSRMILGETVDKLGLTQQAKQRVLPVVGRLWQRLQGRGQGKITLGELQIPQVEGKAQGLTLTVQE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGKYHLTGENIEADGRVGKTLVTQGIVLLVTSIEATPGTQFSLKSLTRLETINALKKSLTVAESEKQSGIVTLTLTGEDP
AGKYHLTGENIEADGRVGKTLVTQGIVLLVTSIEATPGTQFSLKSLTRLETINALKKSLTVAESEKQSGIVTLTLTGEDP

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNIARVLNAIADNYLQQNIARQEAQDSRSLDFLQEQLPKIRADLDQAEARLNAYRAQRDSVDLSLEAKSVLDQVVNVENQ
DNIARVLNAIADN                                                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNELTFREAEISQLFKKSHPTYRALHEKRQTLERERDRLNNRVSAMPSTQQEILRLSRDVESGRTIYLQLLTRQQELNIS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSSAVGNVRIIDEAVTHPDPIKPRKALIIILGALFGLMLAMGTVLVRQAFKRGITLSEQLEAQGLPVLATLPRSQWLWSK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
THLRRKNPFSRRWKHKTSNVPFLPVDRPADMFVEAVRGLRTSLYFAMMEAENRIVMISGPTQDCGKTLVATNLAAVAGQS
                                                         SGPTQDCGKTLVATNLAAVAGQS
                                                                GKT             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQRVLFIDADMRQGYVHNIFGLENRYGLSCLLEGKCDCTEVIQHAEKAGIDVITCGPEPLRPLELLLSERFLDIMSWVNE
GQRVLFIDADMRQGYVHNIFGLENRYGLSCLLEGKCDCTEVIQHAEKAGIDVITCGPEPLRPLELLLSERFLDIMSWVNE
    LFIDADMR                                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYDIVIIDTPPVLAVTDASLVARAAGTTLMVARFDKTSVKEMENTVKRLQHVGVKVSGTILNDIVKSAALFYSSGYSQCD
QYDIVIIDTPPVLAVTDASLVARAAGTTLMVARFDKTSVKEMENTVKRLQHVGVKVSGTILNDIVKSAALFYSSGYSQCD
    VIIDTPP                                                            YSSGYSQCD
       730  
....:....|..
YGYASKKKGDRR
YGYASKK     
YGY         

© 1998-2019