BYKdb

Annotate results for A0A0J1B4A0

A0A0J1B4A0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J1B4A0
DOMAINtad29/174LDIDLDLLGIVRRRYHLIALGIFVGVTLATIYFVNQVPIYESKLAVLVGQRSGEVANTGV
NNGAKDMASMQEDVLSTHMELFASPKILENAIQIAGLNVKVGDLAENLSVSKGGDGLAKS
ASVLKATYQDPDPEVAAAALQAIFDS
DOMAINcd585/777TSPSPSDGKSTTIANLAVSVAQTGKRVLLIDADMRRPTVAANFGVERSPGLSDLLSHDGP
INPATLAECVQASEQDSLTLCTSGSRTSEPSELLESDQWVAFLDLARKTYDVILIDTPPL
LAVADPSIVADEVDGVFLAVRIEKNNRTLVERATEVLTDKGIAIEGVIVNSRDSRSNHYA
YSSYDYYGKKQYG
SITEWalker A592/594GKS
SITEWalker A'612/619LLIDADMR
SITEWalker B697/703ILIDTPP
SITEY Cluster763/786YAYSSYDYYGKKQYGYVANYRRYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLFADQSIEFLKIMIRSNPSADDVNGDELDIDLDLLGIVRRRYHLIALGIFVGVTLATIYFVNQVPIYESKLAVLVGQRS
                            LDIDLDLLGIVRRRYHLIALGIFVGVTLATIYFVNQVPIYESKLAVLVGQRS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GEVANTGVNNGAKDMASMQEDVLSTHMELFASPKILENAIQIAGLNVKVGDLAENLSVSKGGDGLAKSASVLKATYQDPD
GEVANTGVNNGAKDMASMQEDVLSTHMELFASPKILENAIQIAGLNVKVGDLAENLSVSKGGDGLAKSASVLKATYQDPD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PEVAAAALQAIFDSYQDYIDEQTSSVGNEAAELIARAQVQNEKALREADQAYREFVASVPALISSNINGRDSLEDVHRLR
PEVAAAALQAIFDS                                                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNNIEQQLGGIRESLSHAKSRRVVIREFVKGKDPDSLSDVHVMSLLDADEIDRVNAFLAISANRDDQTNDEMLSRAVMQE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STRTEYQQLLTLSSKERLMAAEFGENHPSVRALRTELDNMRRFVDESRENRPEEDKRVEAKPADILASYYQVLQSDISEM


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKREEQLLELSEKESKLAKEVETTFLLGSSLKANLDRAQARYDEVFQRLHEINLTNDYSGFSTDLIVMPLPASVPVWPSR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TKIAALGILAGGMLGLALALLAEMTDRTFHDPAEVERIVGASILAHVPRLKESALKKKVKEGSGISAMIPTFHLPRGTEA


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETFRVLRTSLLFLTKSQSKKVFLLTSPSPSDGKSTTIANLAVSVAQTGKRVLLIDADMRRPTVAANFGVERSPGLSDLLS
                        TSPSPSDGKSTTIANLAVSVAQTGKRVLLIDADMRRPTVAANFGVERSPGLSDLLS
                               GKS                 LLIDADMR                     
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HDGPINPATLAECVQASEQDSLTLCTSGSRTSEPSELLESDQWVAFLDLARKTYDVILIDTPPLLAVADPSIVADEVDGV
HDGPINPATLAECVQASEQDSLTLCTSGSRTSEPSELLESDQWVAFLDLARKTYDVILIDTPPLLAVADPSIVADEVDGV
                                                        ILIDTPP                 
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FLAVRIEKNNRTLVERATEVLTDKGIAIEGVIVNSRDSRSNHYAYSSYDYYGKKQYGYVANYRRYYEANDDDDAGSAPRR
FLAVRIEKNNRTLVERATEVLTDKGIAIEGVIVNSRDSRSNHYAYSSYDYYGKKQYG                       
                                          YAYSSYDYYGKKQYGYVANYRRYY              
       810       820       830       840    
....:....|....:....|....:....|....:....|....
KRSSSKRTAAASTRSLPIPEAASSNGHVANGSTVNGSSNGHPTT


© 1998-2019