BYKdb

Annotate results for A0A0J1B8S4

A0A0J1B8S4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J1B8S4
DOMAINcd613/802TSPLPGDGKSTIAGNLACSIAQSGKRTLIIDCDLRRPQVTDNFAKADQLGLVDVLSGKCE
HVDAAHDTPLSTLKMMPSGPIPANPAEALTLPEMSELLDVLREEYDYIILDTPPLLVVTD
PSITASMTDGVVMALKVRRKSKPNAKEAASILANVGAKLLGVVINASDEAGNNDGYKGYG
YYRYGRHTSR
SITEWalker A620/622GKS
SITEWalker A'640/647LIIDCDLR
SITEWalker B720/726IILDTPP
SITE-717/-719YDY
SITEY Cluster788/804YKGYGYYRYGRHTSRYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTPNSNSTDPTAGKRGPNSFASYPSQNAGTMGLAATGSYPAMNEGWGSADQGDASDLLGAIWRYRWAAMGPTILGAMIGF


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVFIKTPETFQSATLLMFESDRPAVIDTMTGDRIGGVPSIEIIRAQLFSDEVNRSALSDGNMNVFREQFHGSPVELAALA


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKMLEFETDLKDERSASSLVAQMTFENTDPELCEAAIKAYSAALQKLFADKHKSSRSELLKLISIATNQMQPKMAELESR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YREFRQDAPLVWDENGQAINPHRERQLYLTARRSELFEELRKKAIELTAIDSISNEAKDPLVRLSIIGQLIGKNFEIPDS


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRISQDMRDGDVELAQIELDQQLVPLMIERNKFAAEFGEQHPTVKALDAELTMMKRELKRLITEQSERIVELMEQNKVEG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDPAKRAEEAVNVVLIASRAEVNLLEQQIGEIDLQIASERKEAIKLAQFEQENTALLREIDRNRELINHLEEQMARVELV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEEGGIRVTELVAPSTAYVIGPSIIKTLGIGTIAGLIIGCGLALLLEKNANTFRDPEEIVAAVGAPILTHVPFFKGRVRR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKGETSNPFEQLDAHLAVVHAPSSVASEAIRSCRTSVLFEMAGIHGGKIIQVTSPLPGDGKSTIAGNLACSIAQSGKRTL
                                                    TSPLPGDGKSTIAGNLACSIAQSGKRTL
                                                           GKS                 L
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIDCDLRRPQVTDNFAKADQLGLVDVLSGKCEHVDAAHDTPLSTLKMMPSGPIPANPAEALTLPEMSELLDVLREEYDYI
IIDCDLRRPQVTDNFAKADQLGLVDVLSGKCEHVDAAHDTPLSTLKMMPSGPIPANPAEALTLPEMSELLDVLREEYDYI
IIDCDLR                                                                        I
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILDTPPLLVVTDPSITASMTDGVVMALKVRRKSKPNAKEAASILANVGAKLLGVVINASDEAGNNDGYKGYGYYRYGRHT
ILDTPPLLVVTDPSITASMTDGVVMALKVRRKSKPNAKEAASILANVGAKLLGVVINASDEAGNNDGYKGYGYYRYGRHT
ILDTPP                                                             YKGYGYYRYGRHT
       810       820       830       840       850    
....:....|....:....|....:....|....:....|....:....|....
SRYYRKTANNGSKAGTRRTPVVVSGRGPAPRSARPIAVPPTAMPPVEQERSSDV
SR                                                    
SRYY                                                  

© 1998-2019