BYKdb

Annotate results for A0A0J1CJY4

A0A0J1CJY4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J1CJY4
DOMAINtad17/274EEFVLRDLVRMIVDQIWWVLGIALGILLVAVLYAKMSTPVYSADALVQVETPSPNSPNSA
QASLAAALMPSAGSMHADAEIEIIKSRAVIDPVVEQFNLNFGTSTNVMPVIGRVTSWFAH
KGHPLPALFGFDAYAWGGEEFKVDSVNVPTILQDQRLTLRALGEGRFALLDAENHELLQG
EAGTVATGNGVTLLVSQLVARPGTEFFVTRASQLEAGQVFGAGMQVAEKGKDTGIVQISY
SGSQPIFITEVANAVAAS
DOMAINcd605/794TSPAPSDGKSFLSANLAALLAESGKRVLLIDADLRRGRLAQYLGRSPHGGLTELLTGQTD
FEMAARETGVHGLHFIGSGAHPPNPSEILTSARFASLLQAFEKQFDLVIVDTPPLLAVPD
AAVIASLAGSTVLVMRSGAHSEKNIADSLKKLKRAHARVVGGVLNAMPAKRGGRNGTYDY
AYAYTYSSDP
SITEWalker A612/614GKS
SITEWalker A'632/639LLIDADLR
SITEWalker B712/718VIVDTPP
SITEY Cluster782/790YDYAYAYTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSTYEMLEHSPTQAKDEEFVLRDLVRMIVDQIWWVLGIALGILLVAVLYAKMSTPVYSADALVQVETPSPNSPNSAQASL
                EEFVLRDLVRMIVDQIWWVLGIALGILLVAVLYAKMSTPVYSADALVQVETPSPNSPNSAQASL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAALMPSAGSMHADAEIEIIKSRAVIDPVVEQFNLNFGTSTNVMPVIGRVTSWFAHKGHPLPALFGFDAYAWGGEEFKVD
AAALMPSAGSMHADAEIEIIKSRAVIDPVVEQFNLNFGTSTNVMPVIGRVTSWFAHKGHPLPALFGFDAYAWGGEEFKVD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVNVPTILQDQRLTLRALGEGRFALLDAENHELLQGEAGTVATGNGVTLLVSQLVARPGTEFFVTRASQLEAGQVFGAGM
SVNVPTILQDQRLTLRALGEGRFALLDAENHELLQGEAGTVATGNGVTLLVSQLVARPGTEFFVTRASQLEAGQVFGAGM

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVAEKGKDTGIVQISYSGSQPIFITEVANAVAASYLKQRTERAQEEANRMLTFLNNELPRVRNELRASETALAQYQTAAG
QVAEKGKDTGIVQISYSGSQPIFITEVANAVAAS                                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFQPTQEAQTYLSGGLDYERQIAALRMQRVQLLQRFTDGADEVRAIDAQLAALNVEKSRFENQFKTLPGSERQAVSLQRE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKVNSEIYVALLNKTQELSISRAGTVGNVHIVDMALVPSQPVKPKAGLIIAAGGLLGVIAGVVFAFVRRAFFAGVDDPDL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VERRFNLPIFGAIPFSAEQARVDRVRLDRPVALPLPSVKGAAGGAKRLGTQPVGDGFVSTPGMAAKTRVAMALKHATVLP


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASRSTTQPLLSTTHPFDTSIEGLRGLRATLQFALVDAPNRVIAITSPAPSDGKSFLSANLAALLAESGKRVLLIDADLRR
                                            TSPAPSDGKSFLSANLAALLAESGKRVLLIDADLRR
                                                   GKS                 LLIDADLR 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRLAQYLGRSPHGGLTELLTGQTDFEMAARETGVHGLHFIGSGAHPPNPSEILTSARFASLLQAFEKQFDLVIVDTPPLL
GRLAQYLGRSPHGGLTELLTGQTDFEMAARETGVHGLHFIGSGAHPPNPSEILTSARFASLLQAFEKQFDLVIVDTPPLL
                                                                       VIVDTPP  
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVPDAAVIASLAGSTVLVMRSGAHSEKNIADSLKKLKRAHARVVGGVLNAMPAKRGGRNGTYDYAYAYTYSSDPLTAEVK
AVPDAAVIASLAGSTVLVMRSGAHSEKNIADSLKKLKRAHARVVGGVLNAMPAKRGGRNGTYDYAYAYTYSSDP      
                                                             YDYAYAYTY          
 
.
Q


© 1998-2019