BYKdb

Annotate results for A0A0J1CKU5

A0A0J1CKU5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J1CKU5
DOMAINtad1/248MLNLMHDHLWEILNVIGIVVALAVVYLLVATPIYSADVLVRVDPPEQNALGIAIQNQETL
PPPAPAPSAEMAVMRSRSVLEPVIERYRFDVSVKPRTIPLLGDLAEKLATPGQPAAPWLG
LKSFAWGGERLQIANLDVPQDLEEEKLNMVVLDGGQYELRGPSNELLLRGAVGKPANSNG
VSMLVAQLVARPGTSFEVIRWNSLDAVKRFGDVIKVTDKVKDSGLIEMQYSDSNRAKAVE
VTNALAQQ
DOMAINcd560/747TGPTPSAGKSFVAANLAVLHAEIGSKVLLIDADMRRGHLASYFGMSNRGGLSEVLSGRIP
VRNALRHVGVHGMSFLACGERPNNPAALLMKQTFRDLLDRLSKQFDLVIIDTPPILAVTD
ASIIASEAGATMLVLRSGMQSEDEIADTVKKLERTEGRIAGAVFNAIPLRRSNRNYEYTT
NYASDTGH
SITEWalker A567/569GKS
SITEWalker A'587/594LLIDADMR
SITEWalker B667/673VIIDTPP
SITEY Cluster735/741YEYTTNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLNLMHDHLWEILNVIGIVVALAVVYLLVATPIYSADVLVRVDPPEQNALGIAIQNQETLPPPAPAPSAEMAVMRSRSVL
MLNLMHDHLWEILNVIGIVVALAVVYLLVATPIYSADVLVRVDPPEQNALGIAIQNQETLPPPAPAPSAEMAVMRSRSVL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPVIERYRFDVSVKPRTIPLLGDLAEKLATPGQPAAPWLGLKSFAWGGERLQIANLDVPQDLEEEKLNMVVLDGGQYELR
EPVIERYRFDVSVKPRTIPLLGDLAEKLATPGQPAAPWLGLKSFAWGGERLQIANLDVPQDLEEEKLNMVVLDGGQYELR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPSNELLLRGAVGKPANSNGVSMLVAQLVARPGTSFEVIRWNSLDAVKRFGDVIKVTDKVKDSGLIEMQYSDSNRAKAVE
GPSNELLLRGAVGKPANSNGVSMLVAQLVARPGTSFEVIRWNSLDAVKRFGDVIKVTDKVKDSGLIEMQYSDSNRAKAVE

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTNALAQQYLATAVASRQSNDSQTLAFINGELPRLLADLRRKEEALRNFRASSNSMQPTSEAQAYLQGGIDFDRQIATLQ
VTNALAQQ                                                                        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQRTQMMEKFTPDSRWVQNIDIQLAQLNKAKAAFDGRFSAMPSSERNSVDLARDAKVAETIYLGMVQKAEQLSVRRASTT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGAHIVDAAIRPLHPTKPSRPIVLGGAVALGLISGMFLVFMRRHVMTGVTDPLFVERRLSVPVIGEILFSQQQVQLARDA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGAARKALPGNRWATSPVWRDSLEDHPFDSNAGATALDGVGTKVLAARFPNDPSVEALREVRTALARDLAHAPNNIVMFT
                                                                               T

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPTPSAGKSFVAANLAVLHAEIGSKVLLIDADMRRGHLASYFGMSNRGGLSEVLSGRIPVRNALRHVGVHGMSFLACGER
GPTPSAGKSFVAANLAVLHAEIGSKVLLIDADMRRGHLASYFGMSNRGGLSEVLSGRIPVRNALRHVGVHGMSFLACGER
      GKS                 LLIDADMR                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNNPAALLMKQTFRDLLDRLSKQFDLVIIDTPPILAVTDASIIASEAGATMLVLRSGMQSEDEIADTVKKLERTEGRIAG
PNNPAALLMKQTFRDLLDRLSKQFDLVIIDTPPILAVTDASIIASEAGATMLVLRSGMQSEDEIADTVKKLERTEGRIAG
                          VIIDTPP                                               
       730       740       750  
....:....|....:....|....:....|..
AVFNAIPLRRSNRNYEYTTNYASDTGHLGMAS
AVFNAIPLRRSNRNYEYTTNYASDTGH     
              YEYTTNY           

© 1998-2019