BYKdb

Annotate results for A0A0J1CSA5

A0A0J1CSA5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J1CSA5
DOMAINtad16/274EDLDLVTILDVMIESRWLIALVTGAFLALGLLYAFATEPVYQTDIMIQVEESPDSSAAKS
MLGDVSSLFDVKSTAAAESQILASRLVVTRAVEQLRTYIEAGPRRFPVIGNWLARQNDNL
STPGLFGFGGYGWGNERIDVQRFDVPQDLESKRFTLAVTDATHYRLSGSDLDQPFTGQVG
RLETIPSSYGNLSLLVNSLHGNAGAEFVLRRYSKLKTIEKLQDNLDVQEKVKQSGILIAS
LQDTKPRRVADLLNAIATL
DOMAINcd551/739TGPAPSVGKSFVSANFATVLSTAGKRVLLIDADLRKGYLHQYFGLERGVGLSEVISGQSS
VEAALHRGVVPDLDFISTGAQPRNPAELLLNDRLLKLVQEVSEAYDIVVIDTAPVLVAAD
AGILAPAAGTVFLVAWASVTKMGEITESVKRLAQSGVEPTGVLFNGLNLMHVKYGYGSKY
GAYRYAAYA
SITEWalker A558/560GKS
SITEWalker A'578/585LLIDADLR
SITEWalker B658/664VVIDTAP
SITE-588/-592YLHQY
SITEY Cluster724/740YGYGSKYGAYRYAAYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNLMTRPPSPPVDKEEDLDLVTILDVMIESRWLIALVTGAFLALGLLYAFATEPVYQTDIMIQVEESPDSSAAKSMLGDV
               EDLDLVTILDVMIESRWLIALVTGAFLALGLLYAFATEPVYQTDIMIQVEESPDSSAAKSMLGDV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSLFDVKSTAAAESQILASRLVVTRAVEQLRTYIEAGPRRFPVIGNWLARQNDNLSTPGLFGFGGYGWGNERIDVQRFDV
SSLFDVKSTAAAESQILASRLVVTRAVEQLRTYIEAGPRRFPVIGNWLARQNDNLSTPGLFGFGGYGWGNERIDVQRFDV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQDLESKRFTLAVTDATHYRLSGSDLDQPFTGQVGRLETIPSSYGNLSLLVNSLHGNAGAEFVLRRYSKLKTIEKLQDNL
PQDLESKRFTLAVTDATHYRLSGSDLDQPFTGQVGRLETIPSSYGNLSLLVNSLHGNAGAEFVLRRYSKLKTIEKLQDNL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVQEKVKQSGILIASLQDTKPRRVADLLNAIATLYVAQNVARKSAEAAQSLQFLDTQLPEIKSRLEVAQARYTAMRDRRG
DVQEKVKQSGILIASLQDTKPRRVADLLNAIATL                                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIDMTEEAKLALAQSADAKTRLLELQQRRDELILRFNPTHPAIRAIDEQLASLRRFTDTSAAQIKLLPDAQQDIVRSMLD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQVNTDLYTSLLNNFQQLQLVKAGKTGNVRLVDTAVTPEDPVKPKRLLVVLGSLLAGGFLGVVVAFVRNMLFRGISDPNE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IERRSGLHVYSTIPLSERQQALSKRIRAKAPGVKMLALDAPEDPSIESFRSLRTALQFTMFNAKNNVVLITGPAPSVGKS
                                                                      TGPAPSVGKS
                                                                             GKS
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FVSANFATVLSTAGKRVLLIDADLRKGYLHQYFGLERGVGLSEVISGQSSVEAALHRGVVPDLDFISTGAQPRNPAELLL
FVSANFATVLSTAGKRVLLIDADLRKGYLHQYFGLERGVGLSEVISGQSSVEAALHRGVVPDLDFISTGAQPRNPAELLL
                 LLIDADLR                                                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NDRLLKLVQEVSEAYDIVVIDTAPVLVAADAGILAPAAGTVFLVAWASVTKMGEITESVKRLAQSGVEPTGVLFNGLNLM
NDRLLKLVQEVSEAYDIVVIDTAPVLVAADAGILAPAAGTVFLVAWASVTKMGEITESVKRLAQSGVEPTGVLFNGLNLM
                 VVIDTAP                                                        
       730       740      
....:....|....:....|....:.
HVKYGYGSKYGAYRYAAYAYESDAKK
HVKYGYGSKYGAYRYAAYA       
   YGYGSKYGAYRYAAYAY      

© 1998-2019