BYKdb

Annotate results for A0A0J1DG44

A0A0J1DG44 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J1DG44
DOMAINtad36/294PAFDLKGYFHTLYDNRWLIGGITAFITLVAVLYALVAKPVYESNLMIHVEEESPNASKNI
LSEASSLFETKKAAIAEMELLRSRMVVSRAVDNLQLYIDVQPKYFPIAGFWFANQNNNGL
SDPGLFGYGGYVWGAEKAEVSVFEVPESWLGREFNLTALGNGRYRFSGGGQRIVFDGAVG
LGYRVPTPEGMVELKVDRMAANPGARFRLRRISRVAMIQAIQSALVITEQGKQSGIIEVK
LQGENARRTHTLLSEIGRE
DOMAINcd572/760AGPTHGLGKSFVSANFAAVMAAAGKRVLLIDADFRSGRLHRYFGVNPDQGLSKAISGAAS
ATEIIHHNVVENLDFIPTGPLPPNRSEFLLDVNLSALLDTLSADYDLVLIDTPPILAAAD
ALIIGAQAGAVFLLARASVTTEAEITESIKRLNYAGMSPQGVLFNDMTYGIARYSTLHQA
SPANQLAFT
SITEWalker A579/581GKS
SITEWalker A'599/606LLIDADFR
SITEWalker B679/685VLIDTPP
SITEY Cluster740/745YGIARY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNIHGEPNSLSRVVHPSPIAGIPFDARTVEGSPDEPAFDLKGYFHTLYDNRWLIGGITAFITLVAVLYALVAKPVYESNL
                                   PAFDLKGYFHTLYDNRWLIGGITAFITLVAVLYALVAKPVYESNL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIHVEEESPNASKNILSEASSLFETKKAAIAEMELLRSRMVVSRAVDNLQLYIDVQPKYFPIAGFWFANQNNNGLSDPGL
MIHVEEESPNASKNILSEASSLFETKKAAIAEMELLRSRMVVSRAVDNLQLYIDVQPKYFPIAGFWFANQNNNGLSDPGL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGYGGYVWGAEKAEVSVFEVPESWLGREFNLTALGNGRYRFSGGGQRIVFDGAVGLGYRVPTPEGMVELKVDRMAANPGA
FGYGGYVWGAEKAEVSVFEVPESWLGREFNLTALGNGRYRFSGGGQRIVFDGAVGLGYRVPTPEGMVELKVDRMAANPGA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFRLRRISRVAMIQAIQSALVITEQGKQSGIIEVKLQGENARRTHTLLSEIGREYMRQNLARKTEEAEKSLAFLNQQLPI
RFRLRRISRVAMIQAIQSALVITEQGKQSGIIEVKLQGENARRTHTLLSEIGRE                          

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKRQLEQAEDRYNQFRNANGTVDLQEEARMSLAQAAAARARRIDLIQKKTELLSRFTEDHPVVAAINRQRKEVDAEIEEV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NARIKALPVLEQDEARLTRDIKVNTDLYTALSNTAQQLRLISVGRVSNVRMVDAPVPPEKPIKPNRPLIVALAVVTGLFL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTLVAFARKAMKGGIDDPQRIERLLRARVVYATIPHSSNQDKLTRKTRDDAEPLPLLANIIPEDAAVESLRSFRAALQFS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPHFKNNVVMFAGPTHGLGKSFVSANFAAVMAAAGKRVLLIDADFRSGRLHRYFGVNPDQGLSKAISGAASATEIIHHNV
           AGPTHGLGKSFVSANFAAVMAAAGKRVLLIDADFRSGRLHRYFGVNPDQGLSKAISGAASATEIIHHNV
                  GKS                 LLIDADFR                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VENLDFIPTGPLPPNRSEFLLDVNLSALLDTLSADYDLVLIDTPPILAAADALIIGAQAGAVFLLARASVTTEAEITESI
VENLDFIPTGPLPPNRSEFLLDVNLSALLDTLSADYDLVLIDTPPILAAADALIIGAQAGAVFLLARASVTTEAEITESI
                                      VLIDTPP                                   
       730       740       750       760 
....:....|....:....|....:....|....:....|.
KRLNYAGMSPQGVLFNDMTYGIARYSTLHQASPANQLAFTG
KRLNYAGMSPQGVLFNDMTYGIARYSTLHQASPANQLAFT 
                   YGIARY                

© 1998-2019