BYKdb

Annotate results for A0A0J1DM87

A0A0J1DM87 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J1DM87
DOMAINcd43/230TSAAPGEGKSTISSNLAVAFSQAGLRTLLLDCDLRKPTVHKIVGLHNSPGLTSLLVGEVK
REDVVKDVGVPNLSVIPSGPVPPNPVELLGSQAMRNVLNAVREEFDMVVVDAPPIVAVTD
AAVLCPLVDGVLLTVAAGEVPRELAQHARSLLENANANVLGVVLNRINPSAQKNYQYYYY
YYSEVAET
SITEWalker A50/52GKS
SITEWalker A'70/77LLLDCDLR
SITEWalker B150/156VVVDAPP
SITEY Cluster217/224YQYYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPLRDSLIVHNDPKSVGSEAFRTLRTNLQFTSPDRQLRVILVTSAAPGEGKSTISSNLAVAFSQAGLRTLLLDCDLRKPT
                                          TSAAPGEGKSTISSNLAVAFSQAGLRTLLLDCDLRKPT
                                                 GKS                 LLLDCDLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VHKIVGLHNSPGLTSLLVGEVKREDVVKDVGVPNLSVIPSGPVPPNPVELLGSQAMRNVLNAVREEFDMVVVDAPPIVAV
VHKIVGLHNSPGLTSLLVGEVKREDVVKDVGVPNLSVIPSGPVPPNPVELLGSQAMRNVLNAVREEFDMVVVDAPPIVAV
                                                                     VVVDAPP    
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
TDAAVLCPLVDGVLLTVAAGEVPRELAQHARSLLENANANVLGVVLNRINPSAQKNYQYYYYYYSEVAETSDD
TDAAVLCPLVDGVLLTVAAGEVPRELAQHARSLLENANANVLGVVLNRINPSAQKNYQYYYYYYSEVAET   
                                                        YQYYYYYY         
© 1998-2019