BYKdb

Annotate results for A0A0J1FRN0

A0A0J1FRN0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J1FRN0
DOMAINcd41/229TSAGPREGKSSTVANLAVSMAQTGKSVLIIDADLRNPTQHKLFGLDNSRGLSMALVQEYE
LDTFIQESSVPGIMVLTGGPIPPNPAELVGSKRMKRLIEEVSGQFDIILIDTPPIVAVTD
AAILAQEVDGVILVVASAEVNRDYAQRAKEQLDKVGAKILGAVLNKADLKTSEYYYYYYY
HGSEAPAKK
SITE-64/-66GKS
SITEWalker A'68/75LIIDADLR
SITEWalker B148/154ILIDTPP
SITEY Cluster214/220YYYYYYY
SITEWalker A48/50GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTYSLITVEQAKSPVSEAFRTFRTNVQFTSVDSETKKIMITSAGPREGKSSTVANLAVSMAQTGKSVLIIDADLRNPTQH
                                        TSAGPREGKSSTVANLAVSMAQTGKSVLIIDADLRNPTQH
                                               GKS                 LIIDADLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLFGLDNSRGLSMALVQEYELDTFIQESSVPGIMVLTGGPIPPNPAELVGSKRMKRLIEEVSGQFDIILIDTPPIVAVTD
KLFGLDNSRGLSMALVQEYELDTFIQESSVPGIMVLTGGPIPPNPAELVGSKRMKRLIEEVSGQFDIILIDTPPIVAVTD
                                                                   ILIDTPP      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAILAQEVDGVILVVASAEVNRDYAQRAKEQLDKVGAKILGAVLNKADLKTSEYYYYYYYHGSEAPAKKRKRHKHEKKTT
AAILAQEVDGVILVVASAEVNRDYAQRAKEQLDKVGAKILGAVLNKADLKTSEYYYYYYYHGSEAPAKK           
                                                     YYYYYYY                    
       250   
....:....|...
FFNLLHRNQKDVS


© 1998-2019