BYKdb

Annotate results for A0A0J1GBR5

A0A0J1GBR5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J1GBR5
DOMAINcd282/472TSSLPSEGKTTFAVNLAQAMADEGKRVVLVDCDLRHPSIGTMLGIESSGEGLQDVIENKL
ELEKAVKKYRDHIMVLCAGKAREDTANVLSNPRFQEILDSLGSEYDYVVIDTPPVSFFTD
ASMISEYADAGIYLVRQDYVEARYVREGMEMLANSELKLVGYVLNYVEAGFLKYGYHNYY
YGKSYRYYKQK
SITEWalker A289/291GKT
SITEWalker A'309/316VLVDCDLR
SITEWalker B389/395VVIDTPP
SITE-386/-425YDYVVIDTPPVSFFTDASMISEYADAGIYLVRQDYVEARY
SITE-463/-465GKS
SITEY Cluster443/469YVLNYVEAGFLKYGYHNYYYGKSYRYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQLYNDKIDIIYDDDKILDVRNFIDNMWNGLKRWKILLLLVFLMTTGGIVAVKSWNYTLLYQAKLTYVVTKTGDAATDVV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ITGRLSASFPDILANTGLSSDIKQKVQIKEEKLPGSIRMYNTSSSNMLNVMITSADYNQANAMMEAFQETYPVYASKNVG


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVELNVIDYTLATENPVNPYPQLKYILMGILSGGCCVFVLLVCYALTRKTIRRETDMKKIVNLDCLAYIPKVKEKKRTNK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVRHILISDKKVSYDFRQAIRSIQSRTAKHLKEENAKILMITSSLPSEGKTTFAVNLAQAMADEGKRVVLVDCDLRHPSI
                                         TSSLPSEGKTTFAVNLAQAMADEGKRVVLVDCDLRHPSI
                                                GKT                 VLVDCDLR    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTMLGIESSGEGLQDVIENKLELEKAVKKYRDHIMVLCAGKAREDTANVLSNPRFQEILDSLGSEYDYVVIDTPPVSFFT
GTMLGIESSGEGLQDVIENKLELEKAVKKYRDHIMVLCAGKAREDTANVLSNPRFQEILDSLGSEYDYVVIDTPPVSFFT
                                                                    VVIDTPP     
       410       420       430       440       450       460       470        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
DASMISEYADAGIYLVRQDYVEARYVREGMEMLANSELKLVGYVLNYVEAGFLKYGYHNYYYGKSYRYYKQKVSDGEN
DASMISEYADAGIYLVRQDYVEARYVREGMEMLANSELKLVGYVLNYVEAGFLKYGYHNYYYGKSYRYYKQK      
                                          YVLNYVEAGFLKYGYHNYYYGKSYRYY         
© 1998-2019