BYKdb

Annotate results for A0A0J1GH23

A0A0J1GH23 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J1GH23
DOMAINtad15/253DEIDIGKLFGILIDSRWSIIFITALFALCGIAYALLSTPVYKADALIQVEQKSSGMTALG
DMGELFASESSATTEIEIIRSRMILGKTVEELNLTTFVIPEYTPVIGKGLARLKKQSIHV
SIPRFEIPDNTAEPTFTLVINDAKAGTYTLLDQQEQPILDGVTGELTKAKDFTLLITSIQ
AIDGSRFTIQKHKPLDAIQTLQQNLSIAERGKQTGILKLSYTGEDRQAIEAILNDISHN
DOMAINcd532/721SGPSPGIGKSFVSANMAAVIAKSDQRVLLIDADMRKGRMEVQMNLDAKPGLSTYLSGQIG
LKEIIKQPGIEGLDFISRGIVPPNPSELLMHPRFKALLEWASENYDIVVIDTPPILAVTD
AAIVGSHAGTSLLVGRFGQSALKEIEITKQRFEQNGVQVKGFILNAVVRKASNYYGGNYG
YYNYSYTSSS
SITEWalker A539/541GKS
SITEWalker A'559/566LLIDADMR
SITEWalker B639/645VVIDTPP
SITEY Cluster705/717YYGGNYGYYNYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSITQNTTVKPVESDEIDIGKLFGILIDSRWSIIFITALFALCGIAYALLSTPVYKADALIQVEQKSSGMTALGDMGELF
              DEIDIGKLFGILIDSRWSIIFITALFALCGIAYALLSTPVYKADALIQVEQKSSGMTALGDMGELF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASESSATTEIEIIRSRMILGKTVEELNLTTFVIPEYTPVIGKGLARLKKQSIHVSIPRFEIPDNTAEPTFTLVINDAKAG
ASESSATTEIEIIRSRMILGKTVEELNLTTFVIPEYTPVIGKGLARLKKQSIHVSIPRFEIPDNTAEPTFTLVINDAKAG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TYTLLDQQEQPILDGVTGELTKAKDFTLLITSIQAIDGSRFTIQKHKPLDAIQTLQQNLSIAERGKQTGILKLSYTGEDR
TYTLLDQQEQPILDGVTGELTKAKDFTLLITSIQAIDGSRFTIQKHKPLDAIQTLQQNLSIAERGKQTGILKLSYTGEDR

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAIEAILNDISHNYFMQNVARNSAEAENSLTFLRTHLPDIKTELTKSEDLLNQFRQQNESIDLGLEAKSTLDVMVNIEAQ
QAIEAILNDISHN                                                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNELTFKESEISQRFTKEHPTYVALLDKRRTLMSERDRLNKQIQKLPKTQREVLRLTRDVEVNQQIYVQLLNKVQELNIV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KASTVGNVRILDTAQSYSIAVKPKKSLIVILATVLGSMFAIAITFIRNAFQRGVESPDQIEALGLPVYASIPMSDWQAEL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKKQRRNKAIKIEDRLLALSNPADLSVEALRSLRTSLHFAMMEAKNNILMISGPSPGIGKSFVSANMAAVIAKSDQRVLL
                                                   SGPSPGIGKSFVSANMAAVIAKSDQRVLL
                                                          GKS                 LL
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADMRKGRMEVQMNLDAKPGLSTYLSGQIGLKEIIKQPGIEGLDFISRGIVPPNPSELLMHPRFKALLEWASENYDIVV
IDADMRKGRMEVQMNLDAKPGLSTYLSGQIGLKEIIKQPGIEGLDFISRGIVPPNPSELLMHPRFKALLEWASENYDIVV
IDADMR                                                                        VV
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDTPPILAVTDAAIVGSHAGTSLLVGRFGQSALKEIEITKQRFEQNGVQVKGFILNAVVRKASNYYGGNYGYYNYSYTSS
IDTPPILAVTDAAIVGSHAGTSLLVGRFGQSALKEIEITKQRFEQNGVQVKGFILNAVVRKASNYYGGNYGYYNYSYTSS
IDTPP                                                           YYGGNYGYYNYSY   
 
.
S
S

© 1998-2019