BYKdb

Annotate results for A0A0J1ID87

A0A0J1ID87 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J1ID87
DOMAINcd42/229TSAGPGEGKSATVANLAVSLAEAGKHVLIIDADLRNPTQHKLFGLSNLEGLSTALVQERA
LRDLIRETKFTGLAVLSSGPIPPNPAELLNSKRMKRFLEEATGEFDTILIDSPPTIAVAD
ASILAQSVDGVILVLASGEVNRDYALRAKEQLEKVGAKLLGVVLNKVEMKTREHYYYYYY
GHEHKKRR
SITEWalker A49/51GKS
SITEWalker A'69/76LIIDADLR
SITEWalker B149/155ILIDSPP
SITEY Cluster216/221YYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLSNLITARKPKSPISEAYRTLRTNVQFTAVDGEVKKILVTSAGPGEGKSATVANLAVSLAEAGKHVLIIDADLRNPTQ
                                         TSAGPGEGKSATVANLAVSLAEAGKHVLIIDADLRNPTQ
                                                GKS                 LIIDADLR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKLFGLSNLEGLSTALVQERALRDLIRETKFTGLAVLSSGPIPPNPAELLNSKRMKRFLEEATGEFDTILIDSPPTIAVA
HKLFGLSNLEGLSTALVQERALRDLIRETKFTGLAVLSSGPIPPNPAELLNSKRMKRFLEEATGEFDTILIDSPPTIAVA
                                                                    ILIDSPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DASILAQSVDGVILVLASGEVNRDYALRAKEQLEKVGAKLLGVVLNKVEMKTREHYYYYYYGHEHKKRRHRREGNLPGPV
DASILAQSVDGVILVLASGEVNRDYALRAKEQLEKVGAKLLGVVLNKVEMKTREHYYYYYYGHEHKKRR           
                                                       YYYYYY                   
       
....:..
DKSGLGF


© 1998-2019