BYKdb

Annotate results for A0A0J1J7S4

A0A0J1J7S4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J1J7S4
DOMAINcd40/229TSCLPNEGKSTLVFRLASSMAEAGKKVLMIDADIRKSVTVARYQADKKVQGLSEYLTGQC
ALDDCLCGTNIENMDFIFTGPVAPNPSELLGSDKFEELIARLRPEYEYIFIDCPPLGSII
DAAIVSTVSDGAVFVIEADIISYKFAQKVKQQLEKSGCKILGAVLNKVDMDGKGYYGRYY
GKYYGKKYGG
SITEWalker A47/49GKS
SITEWalker A'67/74LMIDADIR
SITEWalker B148/154IFIDCPP
SITE-145/-147YEY
SITEY Cluster214/235YYGRYYGKYYGKKYGGYYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKVNFEKIDALNFQSSEAYKTLRTNIQFCGEKIKVVSFTSCLPNEGKSTLVFRLASSMAEAGKKVLMIDADIRKSVTVA
                                       TSCLPNEGKSTLVFRLASSMAEAGKKVLMIDADIRKSVTVA
                                              GKS                 LMIDADIR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYQADKKVQGLSEYLTGQCALDDCLCGTNIENMDFIFTGPVAPNPSELLGSDKFEELIARLRPEYEYIFIDCPPLGSIID
RYQADKKVQGLSEYLTGQCALDDCLCGTNIENMDFIFTGPVAPNPSELLGSDKFEELIARLRPEYEYIFIDCPPLGSIID
                                                                   IFIDCPP      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAIVSTVSDGAVFVIEADIISYKFAQKVKQQLEKSGCKILGAVLNKVDMDGKGYYGRYYGKYYGKKYGGYYGYGYGEKDV
AAIVSTVSDGAVFVIEADIISYKFAQKVKQQLEKSGCKILGAVLNKVDMDGKGYYGRYYGKYYGKKYGG           
                                                     YYGRYYGKYYGKKYGGYYGYGY     
       250 
....:....|.
QNAAKEAVAGN


© 1998-2019