BYKdb

Annotate results for A0A0J1VVL3

A0A0J1VVL3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J1VVL3
DOMAINtad18/254EDVDLFQILKVLYYSKVWIAVTTLLFIAFGIVIAYSLAPVYKSDALIQVEKNASTGLLNK
LSTMLPEGSGVASESEISLIKSRMVIGKTVRDLALDISVTEKRYPFANALLLRLFGKPTG
KIEISTLAVPEAFLNEAMILTITMAGDYTLQVGETVLQGNVGVPLHAHGIDFMIEHAELT
QNTVFILRKHNEYSVIDEIKNNLVVDGKSGGNGMLHLSMTGSDPVMISKILETISHN
DOMAINcd531/715SGTSPGVGKSFISSNLAVLMAQAGTRVLVIDCDLRRGYLHSIFSQTDGHAGLADYLSSDA
EVARVIEETEYQGVDFIGRGRMVNNPAELFMTPKFRTLIDACSAQYDVIILDTPPILSVT
DAAIIGRFASTSLMVVRFEQNSIQEVEAGLRRFDQNGIAIQGVIFNGVEKRASASYSYGD
YSYQE
SITEWalker A538/540GKS
SITEWalker A'558/565LVIDCDLR
SITEWalker B639/645IILDTPP
SITEY Cluster706/713YSYGDYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFDKHISKSQTDNVPREEDVDLFQILKVLYYSKVWIAVTTLLFIAFGIVIAYSLAPVYKSDALIQVEKNASTGLLNKLST
                 EDVDLFQILKVLYYSKVWIAVTTLLFIAFGIVIAYSLAPVYKSDALIQVEKNASTGLLNKLST

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLPEGSGVASESEISLIKSRMVIGKTVRDLALDISVTEKRYPFANALLLRLFGKPTGKIEISTLAVPEAFLNEAMILTIT
MLPEGSGVASESEISLIKSRMVIGKTVRDLALDISVTEKRYPFANALLLRLFGKPTGKIEISTLAVPEAFLNEAMILTIT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAGDYTLQVGETVLQGNVGVPLHAHGIDFMIEHAELTQNTVFILRKHNEYSVIDEIKNNLVVDGKSGGNGMLHLSMTGSD
MAGDYTLQVGETVLQGNVGVPLHAHGIDFMIEHAELTQNTVFILRKHNEYSVIDEIKNNLVVDGKSGGNGMLHLSMTGSD

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVMISKILETISHNYLAQDVARKSEEASKSLAFVNEQLLQIKNNLVTAENKLNDFRKNNESVDLSLEAKFILDNVVSIDT
PVMISKILETISHN                                                                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLNELTFKEAEISKLYKRSHPAYKALSEKRAVLQEEKEKLNQRISTMPRTQQEILSMTRDVQMGNDIYMLLLNKQHELNI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKASTLGNVRIIDNAVTQHKPVKPKKLLIVILSALTGFLFASGVILIRNMLIKGIKQPAELEKRGIPVHAVVPLAPERTK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRRCRAITTYQSDELLAKSSPTSLAVEAIRGLRTSLHFAMLKAENKILMISGTSPGVGKSFISSNLAVLMAQAGTRVLVI
                                                  SGTSPGVGKSFISSNLAVLMAQAGTRVLVI
                                                         GKS                 LVI
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DCDLRRGYLHSIFSQTDGHAGLADYLSSDAEVARVIEETEYQGVDFIGRGRMVNNPAELFMTPKFRTLIDACSAQYDVII
DCDLRRGYLHSIFSQTDGHAGLADYLSSDAEVARVIEETEYQGVDFIGRGRMVNNPAELFMTPKFRTLIDACSAQYDVII
DCDLR                                                                         II
       650       660       670       680       690       700       710     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
LDTPPILSVTDAAIIGRFASTSLMVVRFEQNSIQEVEAGLRRFDQNGIAIQGVIFNGVEKRASASYSYGDYSYQE
LDTPPILSVTDAAIIGRFASTSLMVVRFEQNSIQEVEAGLRRFDQNGIAIQGVIFNGVEKRASASYSYGDYSYQE
LDTPP                                                            YSYGDYSY  

© 1998-2019