BYKdb

Annotate results for A0A0J5GMQ2

A0A0J5GMQ2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J5GMQ2
DOMAINcd52/231TSTSPGEGKSTTSANLAVVMAQNGNRVLFIDGDMRKPTAHYTFGVLNTKGLXNVLTRQVS
LEEAVSQTKIENLEILTCGPIPPNPAEXLNSKGMELLLEKTKEQYEVIIIDTPPVMAVTD
SQLLANKCDGTVLVVCSGKTDRQMALKAKDLLSQAKAKLLGVVLNKKEVKPGDNYYYYYE
SITE-189/-191GKT
SITEWalker A'79/86LFIDGDMR
SITEWalker B159/165IIIDTPP
SITEY Cluster226/230YYYYY
SITEWalker A59/61GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARPNKQVKENNKRGLITHTNRKSPISEQYRTIRTNIEFAAVDEPIRTIVVTSTSPGEGKSTTSANLAVVMAQNGNRVLF
                                                   TSTSPGEGKSTTSANLAVVMAQNGNRVLF
                                                          GKS                 LF
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDGDMRKPTAHYTFGVLNTKGLXNVLTRQVSLEEAVSQTKIENLEILTCGPIPPNPAEXLNSKGMELLLEKTKEQYEVII
IDGDMRKPTAHYTFGVLNTKGLXNVLTRQVSLEEAVSQTKIENLEILTCGPIPPNPAEXLNSKGMELLLEKTKEQYEVII
IDGDMR                                                                        II
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
IDTPPVMAVTDSQLLANKCDGTVLVVCSGKTDRQMALKAKDLLSQAKAKLLGVVLNKKEVKPGDNYYYYYE
IDTPPVMAVTDSQLLANKCDGTVLVVCSGKTDRQMALKAKDLLSQAKAKLLGVVLNKKEVKPGDNYYYYYE
IDTPP                                                            YYYYY 
© 1998-2019