BYKdb

Annotate results for A0A0J5P8Z5

A0A0J5P8Z5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J5P8Z5
DOMAINtad7/243YQIDLVKLFGSLLDHKWLIACITLAFSLLGGVYSLLVTPIYTANATIQIEKNSTASIFKD
FTSILDQQSYVQTEISILKSRLVLEKTVQELNLTTQISAIYPIPFISKALERLFGDYSDI
TIAEFEPTNESFEQLILEIAPEENQYSLFSDTGELLLKGMINHKYSNNNFTIQVSKLKGS
IGKKFRISKISHLLSIQKLQKNLLVSEKGKQTGVIEISLNGENKNQIKQIVKSVSDN
DOMAINcd520/703SGSSPSVGKSFISLNFSNIAAKAGQKVLLIDMDLRRSYIHKLLGLEESPGISDILTNHID
FKEAIITKSNLSFDILTKGTFVKNPAEILSSKRVQDLFQWASKNYDLVIVDTPPILAVTD
AAIIGNYISMVFLIGRYEQTTLREVKLSKEIFEKSGVLVKGFILNGIKRKASNRYDYYQY
DYTS
SITEWalker A527/529GKS
SITEWalker A'547/554LLIDMDLR
SITEWalker B627/633VIVDTPP
SITEY Cluster694/701YDYYQYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNKNDEYQIDLVKLFGSLLDHKWLIACITLAFSLLGGVYSLLVTPIYTANATIQIEKNSTASIFKDFTSILDQQSYVQTE
      YQIDLVKLFGSLLDHKWLIACITLAFSLLGGVYSLLVTPIYTANATIQIEKNSTASIFKDFTSILDQQSYVQTE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISILKSRLVLEKTVQELNLTTQISAIYPIPFISKALERLFGDYSDITIAEFEPTNESFEQLILEIAPEENQYSLFSDTGE
ISILKSRLVLEKTVQELNLTTQISAIYPIPFISKALERLFGDYSDITIAEFEPTNESFEQLILEIAPEENQYSLFSDTGE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLLKGMINHKYSNNNFTIQVSKLKGSIGKKFRISKISHLLSIQKLQKNLLVSEKGKQTGVIEISLNGENKNQIKQIVKSV
LLLKGMINHKYSNNNFTIQVSKLKGSIGKKFRISKISHLLSIQKLQKNLLVSEKGKQTGVIEISLNGENKNQIKQIVKSV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDNYISQNILRSSEDASKSLDFLQNRLPEIRENLANSENTLNEYRQKNSSIDLSLETKSYLDTLVRLDTDLNVLLSKESE
SDN                                                                             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISQKFTKRHPNYISLLEQKRVLLREKEKISRQISDLPDTQKEILRLSRDLEIEQQIYIQLLKKMQELDVIKAGIIGNARV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDIAQVMPDIVFPKKMLIVALSTLLGIVFSFAFVMLKMLFRRTIESVDEIQEQIGLVVYGTIPFSREQIEVSVDKIYKRS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYPLLSDFNPADLSIEALRSLRTSIHFAMMETNNNIIAFSGSSPSVGKSFISLNFSNIAAKAGQKVLLIDMDLRRSYIHK
                                       SGSSPSVGKSFISLNFSNIAAKAGQKVLLIDMDLRRSYIHK
                                              GKS                 LLIDMDLR      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLGLEESPGISDILTNHIDFKEAIITKSNLSFDILTKGTFVKNPAEILSSKRVQDLFQWASKNYDLVIVDTPPILAVTDA
LLGLEESPGISDILTNHIDFKEAIITKSNLSFDILTKGTFVKNPAEILSSKRVQDLFQWASKNYDLVIVDTPPILAVTDA
                                                                  VIVDTPP       
       650       660       670       680       690       700   
....:....|....:....|....:....|....:....|....:....|....:....|...
AIIGNYISMVFLIGRYEQTTLREVKLSKEIFEKSGVLVKGFILNGIKRKASNRYDYYQYDYTS
AIIGNYISMVFLIGRYEQTTLREVKLSKEIFEKSGVLVKGFILNGIKRKASNRYDYYQYDYTS
                                                     YDYYQYDY  

© 1998-2019