BYKdb

Annotate results for A0A0J5Q9T7

A0A0J5Q9T7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J5Q9T7
DOMAINcd222/406TSPTKDCGKTFTAANLAISLSRQENCRTLLLDMDLRNPSMHKIFGVKSPGSIGALLRAET
NAAAHLQRPARNTIHAGRSIAFAFNDTAEPYASELLQDPQSTQALHDLETQLAPDVVLFD
LPPALYYDDVIAFRPQYDGVLLVVGGGMTTQDEIKEVERRLGKDTPLLGVVLNKAEGANP
RKYSY
SITEWalker A229/231GKT
SITEWalker A'250/257LLLDMDLR
SITEWalker B338/344VLFDLPP
SITE-347/-348YY
SITEY Cluster404/406YSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAERRKFHRRHGPTQDATGTQPAEDLAPISPLETRAERQARRTAERIRANAAQSIVEEQTQRRADAQAKAQAPRAAAAAQ


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVLRAEETQASERLKREATERAEAERVTRDEAVRVKAERLKQLASERRAHMVAEASRKRVEVAPPDPGAPQSGTLIRPHD


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAPVPVDTWARMREFPINEQLLERNRIVTAHRDDPAHASFDVLRTRLLQALAQNGWKRVAITSPTKDCGKTFTAANLAIS
                                                             TSPTKDCGKTFTAANLAIS
                                                                    GKT         
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSRQENCRTLLLDMDLRNPSMHKIFGVKSPGSIGALLRAETNAAAHLQRPARNTIHAGRSIAFAFNDTAEPYASELLQDP
LSRQENCRTLLLDMDLRNPSMHKIFGVKSPGSIGALLRAETNAAAHLQRPARNTIHAGRSIAFAFNDTAEPYASELLQDP
         LLLDMDLR                                                               
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSTQALHDLETQLAPDVVLFDLPPALYYDDVIAFRPQYDGVLLVVGGGMTTQDEIKEVERRLGKDTPLLGVVLNKAEGAN
QSTQALHDLETQLAPDVVLFDLPPALYYDDVIAFRPQYDGVLLVVGGGMTTQDEIKEVERRLGKDTPLLGVVLNKAEGAN
                 VLFDLPP                                                        
      
....:.
PRKYSY
PRKYSY
   YSY
© 1998-2019